(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE352

CAGLA1_12.PE352      Location/Qualifiers
FT   CDS             809185..809559
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349258"
FT                   /locus_tag="CAGL0M08096g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62674.1"
FT                   /db_xref="HOGENOM:HBG124101"
FT                   /db_xref="UniParc:UPI00003B7138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ96"
FT                   /transl_table=1
FT                   /translation="MQLKNTPLFVTCIEYTHTLPNNTRTPSNLNKYLTTIGKLTLLTNE
FT                   CIPDADFLSNSVEVHEPSFETVVMMLQLCELPNVSSTDGKFHHTDITPRVGLLPSVRLG
FT                   RSHHRLRQYRKSFAPIREFH"
     MQLKNTPLFV TCIEYTHTLP NNTRTPSNLN KYLTTIGKLT LLTNECIPDA DFLSNSVEVH        60
     EPSFETVVMM LQLCELPNVS STDGKFHHTD ITPRVGLLPS VRLGRSHHRL RQYRKSFAPI       120
     REFH                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page