(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE355

CAGLA1_12.PE355      Location/Qualifiers
FT   CDS             complement(814364..815722)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093298" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439011"
FT                   /locus_tag="CAGL0M08184g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="mating-type factor pheromone receptor activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62677.1"
FT                   /db_xref="GO:0004932"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124102"
FT                   /db_xref="HOGENOM:HBG395950"
FT                   /db_xref="InterPro:IPR001499"
FT                   /db_xref="UniParc:UPI00003B713B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ93"
FT                   /transl_table=1
FT                   /translation="MSFESAIIGLCTLGMLALVPPLAWHTKTKNTPAVILIMWLILMDF
FT                   KCIVNAAIWSGSDFMMKWEGKGWCDIVIKLEVGANVGISCAVTNIIYNLHKILKADNAL
FT                   LKHNSWRKIAQDLSISLLTPIMVMALSYLVQVFRFGIARCYGCLNILSPTWVTTVVYTM
FT                   WLLIWSSIGSIYAVLVLIVYYRKRKDVKDILYCTNSGLNITRFARLLIFCFLIILVMFP
FT                   FSIYLFVKDLRQVGTKFSFRATHSKEFWGTILKFDVGHKFVNVWIYVLMSYLVFLIFGL
FT                   GTDALDMYASFMRLIGLGFTLDKFSAKRDEKNNNRFSAFMESIILHQNSDMQQRYSESL
FT                   TPTSQDCTFDCEMGNFKDAMFSNKPYHINVKKSYVLNDCVLEKIPQGQYLLSDLYSYDD
FT                   QITFHQHSANSLGSLGHVYSISYRSEVNSANTNKEIDTEGSSNGSPITRVESG"
     MSFESAIIGL CTLGMLALVP PLAWHTKTKN TPAVILIMWL ILMDFKCIVN AAIWSGSDFM        60
     MKWEGKGWCD IVIKLEVGAN VGISCAVTNI IYNLHKILKA DNALLKHNSW RKIAQDLSIS       120
     LLTPIMVMAL SYLVQVFRFG IARCYGCLNI LSPTWVTTVV YTMWLLIWSS IGSIYAVLVL       180
     IVYYRKRKDV KDILYCTNSG LNITRFARLL IFCFLIILVM FPFSIYLFVK DLRQVGTKFS       240
     FRATHSKEFW GTILKFDVGH KFVNVWIYVL MSYLVFLIFG LGTDALDMYA SFMRLIGLGF       300
     TLDKFSAKRD EKNNNRFSAF MESIILHQNS DMQQRYSESL TPTSQDCTFD CEMGNFKDAM       360
     FSNKPYHINV KKSYVLNDCV LEKIPQGQYL LSDLYSYDDQ ITFHQHSANS LGSLGHVYSI       420
     SYRSEVNSAN TNKEIDTEGS SNGSPITRVE SG                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page