(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE357

CAGLA1_12.PE357      Location/Qualifiers
FT   CDS             complement(818072..820594)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439012"
FT                   /gene_name="LST4"
FT                   /locus_tag="CAGL0M08228g"
FT                   /product="Protein LST4"
FT                   /biological_process="amino acid transport"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAG62679.1"
FT                   /db_xref="GO:0006865"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG124103"
FT                   /db_xref="HOGENOM:HBG202403"
FT                   /db_xref="UniParc:UPI00003B713D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ91"
FT                   /transl_table=1
FT                   /translation="MGERFEGLENLNDECKVKLFGCRMRAPGSGTGGHESIEYRLLILE
FT                   ENAEMVCRQRYRTILDYSSRGHGSMGLKHDEMTNGNVSAPFITASELRQYIYGSPIRSK
FT                   TRVTEDKFRIIPNSRQLLITRVFYPRRTSMNLHGTFPKNYQSSDRRVSITMCLPSYLLA
FT                   DISDSWADIDGWLTQTERHLMATSFHVVETQDNFVTLVNKLLIPALRSCHEIPRLFLYP
FT                   QDNIDFIHTWFKDVFNWIELKEGTKLSFLPFLIAKTLIEYRDDPQESECHRIVITSGNL
FT                   VIANKLVFILGGLLKPRYDGEMKIMITPVSTPTPSNHLMPPSMNGSNESSYHSSSNSHT
FT                   PSKLKIPATINEHRPSRPRYSSTENIHVQSRTMDIPIVKSDQSPFSTSRGWKIPSSYRS
FT                   ATSSVSISSDESLAEVIQPSSLKSTTSIPFQNFSSSLSNQLYSSSYGSWFNGSITGSFT
FT                   NSNPLSNGTSNMATFSSSFKKNNISSIFQSNSPTAGTDSWERPENNTGLNPNITLQRTA
FT                   SNSSLRHMLTPYQQQLISPSTNSEYDEYPWFGATNNAGGATVGTSSETVGSQQPVLLQG
FT                   AHMDTTTLLDSIRTSNNNGAYTFPLKNVGFDRDCSSLDHHKLLTSCFEEIFEGDIDANK
FT                   VTTMVPCSDIAVHIHSKQEDSEGVTSHPRVVIDVDIPGTTISKYPEELLPRYTMYLSHF
FT                   NPFFKLQAIPATNEIENKIVHGLKRDFISEKCDVSKTLFISMRSRSIKEIVVRKTTSIN
FT                   TPSNSSNQDPRNKSKGSMLKQKIKKVFSNGTCTGRVTPVLNNCVAFVEAALMSAMSLYS
FT                   DPTIDKKYRDERILKIFLAVAHYNVDEV"
     MGERFEGLEN LNDECKVKLF GCRMRAPGSG TGGHESIEYR LLILEENAEM VCRQRYRTIL        60
     DYSSRGHGSM GLKHDEMTNG NVSAPFITAS ELRQYIYGSP IRSKTRVTED KFRIIPNSRQ       120
     LLITRVFYPR RTSMNLHGTF PKNYQSSDRR VSITMCLPSY LLADISDSWA DIDGWLTQTE       180
     RHLMATSFHV VETQDNFVTL VNKLLIPALR SCHEIPRLFL YPQDNIDFIH TWFKDVFNWI       240
     ELKEGTKLSF LPFLIAKTLI EYRDDPQESE CHRIVITSGN LVIANKLVFI LGGLLKPRYD       300
     GEMKIMITPV STPTPSNHLM PPSMNGSNES SYHSSSNSHT PSKLKIPATI NEHRPSRPRY       360
     SSTENIHVQS RTMDIPIVKS DQSPFSTSRG WKIPSSYRSA TSSVSISSDE SLAEVIQPSS       420
     LKSTTSIPFQ NFSSSLSNQL YSSSYGSWFN GSITGSFTNS NPLSNGTSNM ATFSSSFKKN       480
     NISSIFQSNS PTAGTDSWER PENNTGLNPN ITLQRTASNS SLRHMLTPYQ QQLISPSTNS       540
     EYDEYPWFGA TNNAGGATVG TSSETVGSQQ PVLLQGAHMD TTTLLDSIRT SNNNGAYTFP       600
     LKNVGFDRDC SSLDHHKLLT SCFEEIFEGD IDANKVTTMV PCSDIAVHIH SKQEDSEGVT       660
     SHPRVVIDVD IPGTTISKYP EELLPRYTMY LSHFNPFFKL QAIPATNEIE NKIVHGLKRD       720
     FISEKCDVSK TLFISMRSRS IKEIVVRKTT SINTPSNSSN QDPRNKSKGS MLKQKIKKVF       780
     SNGTCTGRVT PVLNNCVAFV EAALMSAMSL YSDPTIDKKY RDERILKIFL AVAHYNVDEV       840
//

If you have problems or comments...

PBIL Back to PBIL home page