(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE358

CAGLA1_12.PE358      Location/Qualifiers
FT   CDS             821047..822765
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439013"
FT                   /locus_tag="CAGL0M08250g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62680.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG058975"
FT                   /db_xref="HOGENOM:HBG202404"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI00003B713E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ90"
FT                   /transl_table=1
FT                   /translation="MIARWLLFSLISSLLCILGALFVPIISRYSSKSHENNNTKLVNYG
FT                   LSLSAGSMMTTALYKMLPAMDPDNRFTVFFGFTFGILISFFLNYVVHAFTSESLIHCAH
FT                   GDDHSHSHGDHDRAHDHDHDHNDSHEYGHGHEHSHEHGNNNNHVHLDDNEADDDLYDPL
FT                   SRHRSVETEHSALLPHGKEGVRRRLSLLDLFSKKHRDIGPCCDSIVKSCGVLSVPADKL
FT                   TCVPLNQRGKCLNEQCHNYMQEVDQRPNHVSSQTDSSYSPNHSNSSSYESQDDAEHKHE
FT                   HTSGVVCLENNIGYDLENLDTYRNNYMLGRRNTIEYQPSAKVSTNAGSTSVRSQAISRP
FT                   SLKGINSAPHYSENAQATKASNHDGHGHDDGHEHFHHHDEEALYSHHHHLETPFSKLLS
FT                   IGLQTCLVLTLHKFPEGLIIFYTNQSDETKSLGLSIFISLLIHNFVEGFAMTLPFYTAF
FT                   ESKWKAILITTILGGGSQPFGAVLGYFIFKSSGGDHKHSDGAPPIMGLLLSITAGFLVV
FT                   ISVQMFQTGVSFSDSHHHHSDDNEEEIAQNHTMGTTCLKWCCAGICLILLSGIFV"
     MIARWLLFSL ISSLLCILGA LFVPIISRYS SKSHENNNTK LVNYGLSLSA GSMMTTALYK        60
     MLPAMDPDNR FTVFFGFTFG ILISFFLNYV VHAFTSESLI HCAHGDDHSH SHGDHDRAHD       120
     HDHDHNDSHE YGHGHEHSHE HGNNNNHVHL DDNEADDDLY DPLSRHRSVE TEHSALLPHG       180
     KEGVRRRLSL LDLFSKKHRD IGPCCDSIVK SCGVLSVPAD KLTCVPLNQR GKCLNEQCHN       240
     YMQEVDQRPN HVSSQTDSSY SPNHSNSSSY ESQDDAEHKH EHTSGVVCLE NNIGYDLENL       300
     DTYRNNYMLG RRNTIEYQPS AKVSTNAGST SVRSQAISRP SLKGINSAPH YSENAQATKA       360
     SNHDGHGHDD GHEHFHHHDE EALYSHHHHL ETPFSKLLSI GLQTCLVLTL HKFPEGLIIF       420
     YTNQSDETKS LGLSIFISLL IHNFVEGFAM TLPFYTAFES KWKAILITTI LGGGSQPFGA       480
     VLGYFIFKSS GGDHKHSDGA PPIMGLLLSI TAGFLVVISV QMFQTGVSFS DSHHHHSDDN       540
     EEEIAQNHTM GTTCLKWCCA GICLILLSGI FV                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page