(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE359

CAGLA1_12.PE359      Location/Qualifiers
FT   CDS             complement(823019..824884)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439014"
FT                   /locus_tag="CAGL0M08272g"
FT                   /product="Similar to uniprot|P36029 Saccharomyces
FT                   cerevisiae YKL174c"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62681.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG202405"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B713F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ89"
FT                   /transl_table=1
FT                   /translation="MIQEYTLIPENIRENIRENMPNLDPHEIFENLHHYVQEDEVTDEP
FT                   EEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGGPLSIMLGFFIS
FT                   GILIWFSSLSLGEIVSKFPMELHVGSAMIAPPRLKLICSWFTGWLMLIGNWTMSTSITF
FT                   AGAQLTISLILMANNELISETHLILFTVIVFYMVVTLVGLVNLKFARFIEIINKVCVYW
FT                   IIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSFLIGFQQSNFTLQGFS
FT                   MLPALADEVKKPEKDIPRGMSTAVLLSTFSGLIFLLPIMLILPDIETIFSNHKVLPIVT
FT                   IFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIPRYDLWTFVPPD
FT                   SQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLCTGRR
FT                   SIKHAPVKIRYKFGWFINIASVLWLLLVMVSVCFPTQLPVTVKGMNYAIVVYVLCLIGI
FT                   TILYFKWGKYNFRLPLSDDAKNNPFSLEAQFPTTKEDNEYEHSGSNAKTANLPEGQASP
FT                   VENPFIGEHENSQTDIDFDVVSVDLQDAIEERDTRLEGQTRNDTN"
     MIQEYTLIPE NIRENIRENM PNLDPHEIFE NLHHYVQEDE VTDEPEEVEH FNYKQELDKS        60
     LLSRNSVIGL GFGLMSPVLG MCTSMGIGML NGGPLSIMLG FFISGILIWF SSLSLGEIVS       120
     KFPMELHVGS AMIAPPRLKL ICSWFTGWLM LIGNWTMSTS ITFAGAQLTI SLILMANNEL       180
     ISETHLILFT VIVFYMVVTL VGLVNLKFAR FIEIINKVCV YWIIYAIIFI DILLLIFHKG       240
     KFRSLKYALF HFDNSMSGYS SAFLSFLIGF QQSNFTLQGF SMLPALADEV KKPEKDIPRG       300
     MSTAVLLSTF SGLIFLLPIM LILPDIETIF SNHKVLPIVT IFTKSTHSMV VSVFLVLLIL       360
     GNLFFSGIGS ITTSSRAVYS FSRDHAIPRY DLWTFVPPDS QSRVPKYSIL LSMGISYFLG       420
     LLALISTAAF NAFIGAAVLC LCSATFIPLV LVLCTGRRSI KHAPVKIRYK FGWFINIASV       480
     LWLLLVMVSV CFPTQLPVTV KGMNYAIVVY VLCLIGITIL YFKWGKYNFR LPLSDDAKNN       540
     PFSLEAQFPT TKEDNEYEHS GSNAKTANLP EGQASPVENP FIGEHENSQT DIDFDVVSVD       600
     LQDAIEERDT RLEGQTRNDT N                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page