(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE36

CAGLA1_12.PE36       Location/Qualifiers
FT   CDS             complement(97304..98599)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436694"
FT                   /locus_tag="CAGL0M00880g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="CAG62360.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG408326"
FT                   /db_xref="HOGENOM:HBG725944"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B7003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK60"
FT                   /transl_table=1
FT                   /translation="MNFNISSKETVELEQKYSAHNYHPLPVVFHKASGAHVWDPEGKEY
FT                   LDFLSAYSAVNQGHCHPKIVKALVDQASTLTLSSRAFSNDVFAVFAKYVTEYFGYEMVL
FT                   PMNTGAEAVETALKLARRWGYEVKKIPDNEAIVLGAQGNFHGRTFGAISLSTDEEDSRK
FT                   HFGPFLTNTTAKNPSKGQAIRYGHIEDLEQAFESHGDKIAAVILEPIQGEAGIVVPPKG
FT                   YLLDVQNLCKKYNSLFICDEIQTGIGRTGKLLCFEHTEGVKPDVVLLGKAISGGVLPVS
FT                   CVLSSREIMSCFTPGSHGSTFGGNPMASRVAIAALDVIKEEKLVERAQKLGDLLQDELR
FT                   KLQAQSDGMISEVRGVGLLTAIVIDSQKAQGRTAWDLCLLMKDKGVLAKPTHDHIIRLA
FT                   PPLVISEEDLLKGVQAMKEALVELPSAPISGH"
     MNFNISSKET VELEQKYSAH NYHPLPVVFH KASGAHVWDP EGKEYLDFLS AYSAVNQGHC        60
     HPKIVKALVD QASTLTLSSR AFSNDVFAVF AKYVTEYFGY EMVLPMNTGA EAVETALKLA       120
     RRWGYEVKKI PDNEAIVLGA QGNFHGRTFG AISLSTDEED SRKHFGPFLT NTTAKNPSKG       180
     QAIRYGHIED LEQAFESHGD KIAAVILEPI QGEAGIVVPP KGYLLDVQNL CKKYNSLFIC       240
     DEIQTGIGRT GKLLCFEHTE GVKPDVVLLG KAISGGVLPV SCVLSSREIM SCFTPGSHGS       300
     TFGGNPMASR VAIAALDVIK EEKLVERAQK LGDLLQDELR KLQAQSDGMI SEVRGVGLLT       360
     AIVIDSQKAQ GRTAWDLCLL MKDKGVLAKP THDHIIRLAP PLVISEEDLL KGVQAMKEAL       420
     VELPSAPISG H                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page