(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE362

CAGLA1_12.PE362      Location/Qualifiers
FT   CDS             832444..832860
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440074"
FT                   /locus_tag="CAGL0M08338g"
FT                   /product="Similar to uniprot|P35996 Saccharomyces
FT                   cerevisiae YKL170w MRPL38"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAG62684.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG384371"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI00003B7142"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ86"
FT                   /transl_table=1
FT                   /translation="MIYLKSIIKVIDNSGAQLAECIKVIGKGSPKSPGRVGDRIVCVIQ
FT                   KARPLTQNITGTATTNRVKKGDICHAIVVRTKQTNEYRRDGSMISFGDNACVLINKNTG
FT                   EPLGTRIMANDGVVDRTLKDKGFNKICSLASKAL"
     MIYLKSIIKV IDNSGAQLAE CIKVIGKGSP KSPGRVGDRI VCVIQKARPL TQNITGTATT        60
     NRVKKGDICH AIVVRTKQTN EYRRDGSMIS FGDNACVLIN KNTGEPLGTR IMANDGVVDR       120
     TLKDKGFNKI CSLASKAL                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page