(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE363

CAGLA1_12.PE363      Location/Qualifiers
FT   CDS             complement(833220..835520)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440075"
FT                   /gene_name="KKQ8"
FT                   /locus_tag="CAGL0M08360g"
FT                   /product="Probable serine/threonine-protein kinase KKQ8 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62685.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124951"
FT                   /db_xref="HOGENOM:HBG202407"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B7143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ85"
FT                   /transl_table=1
FT                   /translation="MPEHEERHSHGVNRSLSLGSSMRSLFKSQRSRGPSDRGANGTPGP
FT                   AQKVDIRVDTASASREHTPVVHKTPQSANPELQQPRHHLGLPNILKLNLTPTNSNPQSK
FT                   SGSPVSQNTSQESLITDTDIEVEDYRPSKDSRRTVRNASPMSSNGNLPINANTVIGPDT
FT                   SSNNIDSMLDGTGLRPFYEEADSSDYIENLRSFPLPTGHYAPGFIQPPKSPTSSRVPSR
FT                   SNSRKGREHAGTVSAAQLPRYNETPGKCILDLEYFKLYEDGHHVHTLKVMTSVNSDANG
FT                   NSHNHASKNDGHLDLPKGDDGSVVRQKSKFSLSGFFKPHSKEDIANADEKLKYAVSLLP
FT                   RNKICSKVETDRDTFAPVFTKTRSHVQSGSDDSSDDDEELDDPSIPKIVNKNAAVGSQE
FT                   LKLINNLSEKIRMGLSTAAKNKHNQSSKHRTPSGAGVQDENQPAFADLYGKCVAVVGHG
FT                   AYGVVKVCARTRDEKDDLPATKTYMDSKKIYFAVKELKPRPSDPIEKFSTRITSEFIIG
FT                   HSLSHYYDKNGEQSAPNILSIIDLLEYNDTFIEVMEFCPAGDLYSLLTARKNKIGKPLH
FT                   PLEADCFMKQLLKGIQFMHDHGVAHCDLKPENILLHPNGLLKICDFGTSCVFQTAWERH
FT                   VHFQTGLQGSEPYVAPEEYNPKKEYDPRLVDCWSIGIVYCTMIMGHYLWRNAARGKDSL
FT                   YDSFYEEMASKKEFYVFEELRHINQEINRLRRIALYQIFQPNPEKRISIDKLLQTGWMR
FT                   HTKCCVPYKNIPR"
     MPEHEERHSH GVNRSLSLGS SMRSLFKSQR SRGPSDRGAN GTPGPAQKVD IRVDTASASR        60
     EHTPVVHKTP QSANPELQQP RHHLGLPNIL KLNLTPTNSN PQSKSGSPVS QNTSQESLIT       120
     DTDIEVEDYR PSKDSRRTVR NASPMSSNGN LPINANTVIG PDTSSNNIDS MLDGTGLRPF       180
     YEEADSSDYI ENLRSFPLPT GHYAPGFIQP PKSPTSSRVP SRSNSRKGRE HAGTVSAAQL       240
     PRYNETPGKC ILDLEYFKLY EDGHHVHTLK VMTSVNSDAN GNSHNHASKN DGHLDLPKGD       300
     DGSVVRQKSK FSLSGFFKPH SKEDIANADE KLKYAVSLLP RNKICSKVET DRDTFAPVFT       360
     KTRSHVQSGS DDSSDDDEEL DDPSIPKIVN KNAAVGSQEL KLINNLSEKI RMGLSTAAKN       420
     KHNQSSKHRT PSGAGVQDEN QPAFADLYGK CVAVVGHGAY GVVKVCARTR DEKDDLPATK       480
     TYMDSKKIYF AVKELKPRPS DPIEKFSTRI TSEFIIGHSL SHYYDKNGEQ SAPNILSIID       540
     LLEYNDTFIE VMEFCPAGDL YSLLTARKNK IGKPLHPLEA DCFMKQLLKG IQFMHDHGVA       600
     HCDLKPENIL LHPNGLLKIC DFGTSCVFQT AWERHVHFQT GLQGSEPYVA PEEYNPKKEY       660
     DPRLVDCWSI GIVYCTMIMG HYLWRNAARG KDSLYDSFYE EMASKKEFYV FEELRHINQE       720
     INRLRRIALY QIFQPNPEKR ISIDKLLQTG WMRHTKCCVP YKNIPR                      766
//

If you have problems or comments...

PBIL Back to PBIL home page