(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE365

CAGLA1_12.PE365      Location/Qualifiers
FT   CDS             complement(836791..838179)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440077"
FT                   /locus_tag="CAGL0M08404g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62687.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B7145"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ83"
FT                   /transl_table=1
FT                   /translation="MQILGENFKEVEIMDSEYDRRKLEEESAGPPGDEPMGQENHEQLE
FT                   NHIDKATESQMSKELVVEDDQYDQGSHNIDYEARNKEEHNNGTNRTDGGHTQGTEQSNE
FT                   QQTESNHEQQQQQRLQQTEQHQQHQMETVKKPLIYGANTSGKYTLSDFQILRTLGTGSF
FT                   GRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDS
FT                   QHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDLKPENI
FT                   LLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEM
FT                   LAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQDLLSKLITRDLSKRLGNLQNGSED
FT                   VKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEINYGVQGEDPYADL
FT                   FREF"
     MQILGENFKE VEIMDSEYDR RKLEEESAGP PGDEPMGQEN HEQLENHIDK ATESQMSKEL        60
     VVEDDQYDQG SHNIDYEARN KEEHNNGTNR TDGGHTQGTE QSNEQQTESN HEQQQQQRLQ       120
     QTEQHQQHQM ETVKKPLIYG ANTSGKYTLS DFQILRTLGT GSFGRVHLIR SNHNGRFYAL       180
     KALKKHTVVK LKQVEHTNDE RRMLSIVSHP FIIRMWGTFQ DSQHVFMVMD YIEGGELFSL       240
     LRKSQRFPNP VAKFYAAEVC LALEYLHSKE IIYRDLKPEN ILLDKNGHIK ITDFGFAKYV       300
     PDVTYTLCGT PDYIAPEVVS TKPYNKSVDW WSFGILIYEM LAGYTPFYDA NTMKTYEHIL       360
     NSELKFPSFF HPDVQDLLSK LITRDLSKRL GNLQNGSEDV KNHPWFSEVV WEKLLARYIE       420
     TPYEPPIQQG QGDTSQFDRY PEEEINYGVQ GEDPYADLFR EF                          462
//

If you have problems or comments...

PBIL Back to PBIL home page