(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE368

CAGLA1_12.PE368      Location/Qualifiers
FT   CDS             848089..849096
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196345"
FT                   /locus_tag="CAGL0M08492g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62690.1"
FT                   /db_xref="HOGENOM:HBG058981"
FT                   /db_xref="HOGENOM:HBG626440"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI00003B7148"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ80"
FT                   /transl_table=1
FT                   /translation="MQYKKSLAATALLASSGLAAYVPGNPWSTLTPSGTYKGGLTDYSS
FT                   TFGIAVQPIATSSSVAKRAVSQIGDGQVQAATKTQAAPVSQIGDGQIQATTKTQAAPVS
FT                   QIGDGQIQAATKTQAAPVSQIGDGQIQAATKTQAAPVSQIGDGQIQAATKTQAAPVSQI
FT                   GDGQIQATTKTQAAPVSQIGDGQIQATTKTTQAASQIGDGQVQAATKTASAASQIADGQ
FT                   VQQNKDPKDPVGAVSCKVDGTLQMNLKGGILTDEKGRIGSIVANRQFQFDGPPPQAGAI
FT                   YAAGWSLTPQGNLALGDSDVFYQCLSGNFYNLYDQSIGAQCHPVHLSAIDLVKC"
     MQYKKSLAAT ALLASSGLAA YVPGNPWSTL TPSGTYKGGL TDYSSTFGIA VQPIATSSSV        60
     AKRAVSQIGD GQVQAATKTQ AAPVSQIGDG QIQATTKTQA APVSQIGDGQ IQAATKTQAA       120
     PVSQIGDGQI QAATKTQAAP VSQIGDGQIQ AATKTQAAPV SQIGDGQIQA TTKTQAAPVS       180
     QIGDGQIQAT TKTTQAASQI GDGQVQAATK TASAASQIAD GQVQQNKDPK DPVGAVSCKV       240
     DGTLQMNLKG GILTDEKGRI GSIVANRQFQ FDGPPPQAGA IYAAGWSLTP QGNLALGDSD       300
     VFYQCLSGNF YNLYDQSIGA QCHPVHLSAI DLVKC                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page