(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE369

CAGLA1_12.PE369      Location/Qualifiers
FT   CDS             complement(849926..850558)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349522"
FT                   /locus_tag="CAGL0M08514g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62691.1"
FT                   /db_xref="HOGENOM:HBG058981"
FT                   /db_xref="HOGENOM:HBG626440"
FT                   /db_xref="UniParc:UPI00003B7149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ79"
FT                   /transl_table=1
FT                   /translation="MQFNKISLLAMASAASAATTSPTTTETKPTTTKFFTPGDNFSTFA
FT                   PNATFSGAAVNFTSTFGIAVQSIDSKSVVSKSLVSTSTTSTLAPSSSTSSAASSTTSSP
FT                   NITIVNKSCKADGTLVMELENGILRDGKGRIGSIVSNRQFQFDGPPPQAGAIYAAGWSV
FT                   TPEGNLALGDSDVFYQCSSGNFYNLYDEYIAEQCHPIHLEVLSLVDC"
     MQFNKISLLA MASAASAATT SPTTTETKPT TTKFFTPGDN FSTFAPNATF SGAAVNFTST        60
     FGIAVQSIDS KSVVSKSLVS TSTTSTLAPS SSTSSAASST TSSPNITIVN KSCKADGTLV       120
     MELENGILRD GKGRIGSIVS NRQFQFDGPP PQAGAIYAAG WSVTPEGNLA LGDSDVFYQC       180
     SSGNFYNLYD EYIAEQCHPI HLEVLSLVDC                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page