(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE371

CAGLA1_12.PE371      Location/Qualifiers
FT   CDS             854646..854813
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440079"
FT                   /locus_tag="CAGL0M08552g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAR58076.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG741476"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI00017BD8F4"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN60"
FT                   /transl_table=1
FT                   /translation="MDSTKIVNIFLAIFLPPVAVFSARGFGTECILSIILTICAWFPGM
FT                   LYALYVVLTD"
     MDSTKIVNIF LAIFLPPVAV FSARGFGTEC ILSIILTICA WFPGMLYALY VVLTD             55
//

If you have problems or comments...

PBIL Back to PBIL home page