(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE373

CAGLA1_12.PE373      Location/Qualifiers
FT   CDS             complement(855443..856036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440081"
FT                   /locus_tag="CAGL0M08580g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62694.1"
FT                   /db_xref="HOGENOM:HBG124108"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI00003B714C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ76"
FT                   /transl_table=1
FT                   /translation="MSIDGYSYLQKYLVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLI
FT                   IRAILLAARGDLAPAFNALLSLTGEDIQLGLPMRRYEFLPDKTLMEQALRAKQEDMLEQ
FT                   LSQLQEPSSKAKSAGSETKEKSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDITDKG
FT                   LISDTKSEEANISVVEPQVENGKSVNPFELLQDE"
     MSIDGYSYLQ KYLVFADIKQ LNTEVEQNVH YEKLVKAFPT VDKLIIRAIL LAARGDLAPA        60
     FNALLSLTGE DIQLGLPMRR YEFLPDKTLM EQALRAKQED MLEQLSQLQE PSSKAKSAGS       120
     ETKEKSVPTG DGVSTEAMTG EAQSEPQMME NNAEDPKDIT DKGLISDTKS EEANISVVEP       180
     QVENGKSVNP FELLQDE                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page