(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE375

CAGLA1_12.PE375      Location/Qualifiers
FT   CDS             complement(859796..860809)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000059940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501698"
FT                   /locus_tag="CAGL0M08624g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="tryptophan-tRNA ligase activity"
FT                   /biological_process="tryptophanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62696.1"
FT                   /db_xref="GO:0004830"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006436"
FT                   /db_xref="HOGENOM:HBG003090"
FT                   /db_xref="HOGENOM:HBG293263"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B714E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ74"
FT                   /transl_table=1
FT                   /translation="MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITI
FT                   PKPDAAQFKQLRREAIASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRM
FT                   TQWKSKSNLREDKDATAKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELT
FT                   RTLAENFNKLYKKQVFPLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETI
FT                   IRKIKKARTDSITDKFYYDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKA
FT                   HVSEVIIEELRVPREKFHQYMEDPQFLDDTVQQGTQRASEIAASTMKETMQTMGFI"
     MVQPTGKFHL GNYLGATRVW KDLCDIKQPG QRLIFGVADL HAITIPKPDA AQFKQLRREA        60
     IASILAVGVD PARASIMYQS AIPAHSQLYW LLSTVAPMGY LNRMTQWKSK SNLREDKDAT       120
     AKELGEVKLG LFGYPVLQAA DILLYKATHV PVGDDQVQHL ELTRTLAENF NKLYKKQVFP       180
     LPRTLLAPTK KILSLTHDTK KMSKSDPNQD GVIYVNDPPE TIIRKIKKAR TDSITDKFYY       240
     DPVHRPGLSN LINIVSGITK QPVHAVEQEL QKFDNYRDLK AHVSEVIIEE LRVPREKFHQ       300
     YMEDPQFLDD TVQQGTQRAS EIAASTMKET MQTMGFI                                337
//

If you have problems or comments...

PBIL Back to PBIL home page