(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE376

CAGLA1_12.PE376      Location/Qualifiers
FT   CDS             861488..862501
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440082"
FT                   /gene_name="CIA1"
FT                   /locus_tag="CAGL0M08646g"
FT                   /product="Probable cytosolic iron-sulfur protein assembly
FT                   protein 1"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62697.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG520580"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B714F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ73"
FT                   /transl_table=1
FT                   /translation="MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNG
FT                   KENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELL
FT                   AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV
FT                   VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGS
FT                   DDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK
FT                   EKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNLWNYQD"
     MPLQLAKSLK LHNDKVWSID FEPVRGLLAT GSTDRAIKVL QLKNGKENLL DVLDDTVHKK        60
     AVRSVAWRPH SDLLAAGSFD STISIWTQSD LDLEEGAKLE MELLAIIEGH ENEVKGISWS       120
     QDGCLLATCS RDKSVWIWET DEAGEEYECI SVLQEHSQDV KHVVWHTKHN LLASSSYDDT       180
     VRIWKDYDDD WECAAVLTGH EGTIWCSDFS KEEDPIRLCS GSDDSTVRVW KYIGDDEDDQ       240
     QEWVCESTLP NAHRSQIYGV AWSPSGRIAS VGADGVLAVY KEKQNDSEVS EWEISATYKA       300
     AHTVYEINTV KWVNIDGKEM LITAGDDGRV NLWNYQD                                337
//

If you have problems or comments...

PBIL Back to PBIL home page