(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE378

CAGLA1_12.PE378      Location/Qualifiers
FT   CDS             complement(865182..866168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045131"
FT                   /locus_tag="CAGL0M08690g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG62699.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059227"
FT                   /db_xref="HOGENOM:HBG717253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B7151"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ71"
FT                   /transl_table=1
FT                   /translation="MVEEDRRWKLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRG
FT                   QLFINNYQKEISVVVKLIYLGLTTALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVL
FT                   SYTSIPYLVTKLSKKVNNRSTNNEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVF
FT                   KRFWGMRYALGHTLSQEEENYRDKSSKSYKILGYIILLQHISKVKPIINKVLSILPQTK
FT                   ETLNAGSNGVGLKEGFAPAATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCL
FT                   MEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRSYPQQVLALRA"
     MVEEDRRWKL PFAGAPSIVQ AHQKDEQIET MLSVKVSELL RGVRGQLFIN NYQKEISVVV        60
     KLIYLGLTTA LSRRTLGEEY VDLIYVNKRG SQLVRGIKRV LFVLSYTSIP YLVTKLSKKV       120
     NNRSTNNEES DDGNESTYTD ILSTMIDLHL MVFYITGTYY DVFKRFWGMR YALGHTLSQE       180
     EENYRDKSSK SYKILGYIIL LQHISKVKPI INKVLSILPQ TKETLNAGSN GVGLKEGFAP       240
     AATPGLLTDV PENFNIDHIK LSNGKELAFI PTESRNCILC LMEMTDPSCL PCGHVFCWDC       300
     ITDWTKENPE CPLCRQRSYP QQVLALRA                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page