(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE380

CAGLA1_12.PE380      Location/Qualifiers
FT   CDS             complement(869007..869768)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196346"
FT                   /locus_tag="CAGL0M08734g"
FT                   /product="FAS1 domain-containing protein CAGL0M08734g "
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAG62701.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="HOGENOM:HBG059223"
FT                   /db_xref="HOGENOM:HBG203230"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI00003B7153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ69"
FT                   /transl_table=1
FT                   /translation="MVALKYVLVPVALVAAKNIVEMITFRDENGKLHRRLAPEEYRGGV
FT                   LDGEESRLLQKRDLEMHPPVDLGVYFSNRPIHRTIDVPDIYLDSQISVLTELDIFASYS
FT                   RNDEKSYDMFRDPESDLIVIAPTNAAITALAKKPWQFPMDIDTMEQAGSSERDIDNAIH
FT                   NNIVNFVRSHVVAYQKDTKTSKDGTVLLQSKQYSMQHSNGKGGDVLLKREGEKYCVASV
FT                   VDEVFHDVQNIYSTKNGVILVIDATLSRPGA"
     MVALKYVLVP VALVAAKNIV EMITFRDENG KLHRRLAPEE YRGGVLDGEE SRLLQKRDLE        60
     MHPPVDLGVY FSNRPIHRTI DVPDIYLDSQ ISVLTELDIF ASYSRNDEKS YDMFRDPESD       120
     LIVIAPTNAA ITALAKKPWQ FPMDIDTMEQ AGSSERDIDN AIHNNIVNFV RSHVVAYQKD       180
     TKTSKDGTVL LQSKQYSMQH SNGKGGDVLL KREGEKYCVA SVVDEVFHDV QNIYSTKNGV       240
     ILVIDATLSR PGA                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page