(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE383

CAGLA1_12.PE383      Location/Qualifiers
FT   CDS             878328..879119
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501701"
FT                   /locus_tag="CAGL0M08800g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62704.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG124111"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00003B7156"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ66"
FT                   /transl_table=1
FT                   /translation="MGQVNMRPSLASQPAHYQLPSIAPNIHPHQYTTSQPPHQQHYHVV
FT                   HTPISRISSENGQQQHMMPPSMNPTAYQGPEQVIIDHGIPTFQYAHQPQHVLRSSIMTG
FT                   ANMSPGQPQPQTIVMGPQPIQHAIDGHLASQTIATPMGTTLLTSSAQLQGQKTKKNTKR
FT                   AMQNRKAQKAFRQRKEQYIKLLENEAKLIDDVMKKNQDLTSENEQLRDCLNRLIEKLKD
FT                   NGIEVDIPSDFLDKINASISASRRLQEQHEEISKSIAGEKS"
     MGQVNMRPSL ASQPAHYQLP SIAPNIHPHQ YTTSQPPHQQ HYHVVHTPIS RISSENGQQQ        60
     HMMPPSMNPT AYQGPEQVII DHGIPTFQYA HQPQHVLRSS IMTGANMSPG QPQPQTIVMG       120
     PQPIQHAIDG HLASQTIATP MGTTLLTSSA QLQGQKTKKN TKRAMQNRKA QKAFRQRKEQ       180
     YIKLLENEAK LIDDVMKKNQ DLTSENEQLR DCLNRLIEKL KDNGIEVDIP SDFLDKINAS       240
     ISASRRLQEQ HEEISKSIAG EKS                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page