(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE384

CAGLA1_12.PE384      Location/Qualifiers
FT   CDS             880145..882508
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440084"
FT                   /locus_tag="CAGL0M08822g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG62705.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG229122"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI00003B7157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ65"
FT                   /transl_table=1
FT                   /translation="MLSRVCRSSLRNSVARVSRYAGPRALALSMVVSGRQVSGSWQTCA
FT                   YGVRYIHSSRPRYVQMRMNPNQGEPEKPPLEQFGTNLTKLARDGKLDPVIGRDEEISRA
FT                   IQILSRRTKNNPVLIGRAGVGKTALIDGLAQRIVAGEVPESLKDKELVALDLGALIAGA
FT                   KYRGEFEERLKKVLEDIDKADGKVIVFIDEVHMLLGLGKTDGSMDASNILKPKLARGLR
FT                   CISATTIDEFKIIEKDPALTRRFQPILLNEPSVQDTISILRGLKERYEVHHGVRITDTA
FT                   LVSAAVLSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDEIQRLDRAIMKIQIELES
FT                   LKKETDPVSIERKEDLEKELERKNEELQRLTKIWEEEKAEIESIKNSKADLEKARIELD
FT                   RCQREGDYAKASELRYAKIPALEEKVKLSETKDSNKENLLHDAVTSDDISKVIAKMTGI
FT                   PMETVLKGDKDRLLYMENSLRERVVGQDEAIEAVSDAVRLQRAGLTSEKRPIASFMFLG
FT                   PTGTGKTELTKALAEFLFDDESNVIRFDMSEFQEKHTVSKLIGAPPGYVLSESGGQLTE
FT                   AVRRKPYAVVLFDEFEKAHPDVCKILLQVLDEGKLTDSLGHHVDFRNTIIVMTSNIGQD
FT                   ILLSDTKLDDEGKIDPSTRNEVIEAMKRSYPPEFINRIDDILVFNRLSKKVLRSIVDIR
FT                   AKEIQERLNDKRMTIEISDTAKEWLTEHGYDQLYGARPLNRLIHRRILNPMATYLLKGQ
FT                   IRNGETVQVDVENKELVVKSNHAEGEIVDEEPEK"
     MLSRVCRSSL RNSVARVSRY AGPRALALSM VVSGRQVSGS WQTCAYGVRY IHSSRPRYVQ        60
     MRMNPNQGEP EKPPLEQFGT NLTKLARDGK LDPVIGRDEE ISRAIQILSR RTKNNPVLIG       120
     RAGVGKTALI DGLAQRIVAG EVPESLKDKE LVALDLGALI AGAKYRGEFE ERLKKVLEDI       180
     DKADGKVIVF IDEVHMLLGL GKTDGSMDAS NILKPKLARG LRCISATTID EFKIIEKDPA       240
     LTRRFQPILL NEPSVQDTIS ILRGLKERYE VHHGVRITDT ALVSAAVLSN RYINDRFLPD       300
     KAIDLVDEAC AVLRLQHESK PDEIQRLDRA IMKIQIELES LKKETDPVSI ERKEDLEKEL       360
     ERKNEELQRL TKIWEEEKAE IESIKNSKAD LEKARIELDR CQREGDYAKA SELRYAKIPA       420
     LEEKVKLSET KDSNKENLLH DAVTSDDISK VIAKMTGIPM ETVLKGDKDR LLYMENSLRE       480
     RVVGQDEAIE AVSDAVRLQR AGLTSEKRPI ASFMFLGPTG TGKTELTKAL AEFLFDDESN       540
     VIRFDMSEFQ EKHTVSKLIG APPGYVLSES GGQLTEAVRR KPYAVVLFDE FEKAHPDVCK       600
     ILLQVLDEGK LTDSLGHHVD FRNTIIVMTS NIGQDILLSD TKLDDEGKID PSTRNEVIEA       660
     MKRSYPPEFI NRIDDILVFN RLSKKVLRSI VDIRAKEIQE RLNDKRMTIE ISDTAKEWLT       720
     EHGYDQLYGA RPLNRLIHRR ILNPMATYLL KGQIRNGETV QVDVENKELV VKSNHAEGEI       780
     VDEEPEK                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page