(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE388

CAGLA1_12.PE388      Location/Qualifiers
FT   CDS             complement(887703..889541)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440086"
FT                   /gene_name="SNF1"
FT                   /locus_tag="CAGL0M08910g"
FT                   /product="Carbon catabolite-derepressing protein kinase "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="nuclear membrane"
FT                   /protein_id="CAG62709.1"
FT                   /db_xref="EMBL:AAB48642.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR015741"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B715B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00372"
FT                   /transl_table=1
FT                   /translation="MENKEHHHHHHHHHHHHSNGSYVSNKVSSLADGSRVGNYQIVKTL
FT                   GEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD
FT                   VIKSKDEIIMVIEYAGNELFDYIVQRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLK
FT                   PENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC
FT                   GVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIVNPLNRISI
FT                   HEIMQDEWFKVDLAEYLVPQDLKQQEQFNKKSGNEENVEEIDDEMVVTLSKTMGYDKDE
FT                   IYEALESSEDTPAYNEIRNAYILIKDNKSLIKDMKQDNNVTQELDTFLSQSPPTFQQNG
FT                   DGMKASEDQKKKHSGRRLASSVTQQRTFHQPPFMDQSKEEDSTISILPTSLPQIHRANM
FT                   LAQGLPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDL
FT                   WTIRVRWKYDSDESRLIEDGVKKIPNLMKIVIQLFQIETNNYLVDFKFDGWESTYGDST
FT                   ISTNMSEDEMSTFSAYPFLHLTTKLIMELAVNSQGN"
     MENKEHHHHH HHHHHHHSNG SYVSNKVSSL ADGSRVGNYQ IVKTLGEGSF GKVKLAYHVT        60
     TGQKVALKII NKKVLAKSDM QGRIEREISY LRLLRHPHII KLYDVIKSKD EIIMVIEYAG       120
     NELFDYIVQR NKMSEQEARR FFQQIISAVE YCHRHKIVHR DLKPENLLLD EHLNVKIADF       180
     GLSNIMTDGN FLKTSCGSPN YAAPEVISGK LYAGPEVDVW SCGVILYVML CRRLPFDDES       240
     IPVLFKNISN GVYTLPKFLS PGASDLIKRM LIVNPLNRIS IHEIMQDEWF KVDLAEYLVP       300
     QDLKQQEQFN KKSGNEENVE EIDDEMVVTL SKTMGYDKDE IYEALESSED TPAYNEIRNA       360
     YILIKDNKSL IKDMKQDNNV TQELDTFLSQ SPPTFQQNGD GMKASEDQKK KHSGRRLASS       420
     VTQQRTFHQP PFMDQSKEED STISILPTSL PQIHRANMLA QGLPAASKIS PLVTKKSKTR       480
     WHFGIRSRSY PLDVMGEIYI ALKNLGAEWA KPSEEDLWTI RVRWKYDSDE SRLIEDGVKK       540
     IPNLMKIVIQ LFQIETNNYL VDFKFDGWES TYGDSTISTN MSEDEMSTFS AYPFLHLTTK       600
     LIMELAVNSQ GN                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page