(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE392

CAGLA1_12.PE392      Location/Qualifiers
FT   CDS             complement(896312..897358)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045132"
FT                   /locus_tag="CAGL0M09020g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62713.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B715F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ57"
FT                   /transl_table=1
FT                   /translation="MSSSKKKSSNPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQ
FT                   AAPAAAAVASMAGGAGGAATATVGGGDATAAIKPPGFIRTGRNIYAQEGFLALYKGLGA
FT                   VVIGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVK
FT                   IRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTV
FT                   YSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGES
FT                   GWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLENLGVFSKP
FT                   TPKPKKLN"
     MSSSKKKSSN PVVNLVAGGT AGLFEALCCH PLDTIKVRMQ IYKRQAAPAA AAVASMAGGA        60
     GGAATATVGG GDATAAIKPP GFIRTGRNIY AQEGFLALYK GLGAVVIGII PKMAIRFSSY       120
     EFYRTLLADK QTGVVSTSNT FIAGVGAGVT EAVLVVNPME VVKIRLQAQH LNPNHDLAKP       180
     KYTNAVQAGY TIIKEEGISA LYRGVSLTAA RQATNQGANF TVYSKLREFL QEYHGTETLP       240
     SWETSCIGLI SGAIGPFSNA PLDTIKTRLQ KDKSTSFKGE SGWKRIAHIG TQLLKEEGFR       300
     ALYKGITPRV MRVAPGQAVT FTVYEFVRRH LENLGVFSKP TPKPKKLN                    348
//

If you have problems or comments...

PBIL Back to PBIL home page