(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE395

CAGLA1_12.PE395      Location/Qualifiers
FT   CDS             complement(904879..909219)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440090"
FT                   /gene_name="BUD4"
FT                   /locus_tag="CAGL0M09086g"
FT                   /product="Bud site selection protein 4 "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="cellular bud neck"
FT                   /protein_id="CAG62716.1"
FT                   /db_xref="GO:0005935"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG124115"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniParc:UPI00003B7161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ54"
FT                   /transl_table=1
FT                   /translation="MEAETTVDSLLKEIDMEMEMQSGNDVAQSNGYLLPLQEIGDETMD
FT                   MLVQYNTENNANSNVNANANANANQWNKVDDPQDLLPMENNYDDDEEQGDESDTTNLLS
FT                   GNKHLTEEESEQVLVDSKNLVLPPSSSKSNLINNLKQVVEDEVSDSQLSNDMDDTRTLN
FT                   FSVKGTEPLLADELQDKEPDMIEVSTIYDGPDMISMADDSDTEDIDLLSKAKKPVSPSK
FT                   IPITNAQTINYFKDAPVEDAKLQTVPDDIPLETKQTTVSNDILSNVETLLPPTLERPSF
FT                   VISNLKEASQSVENLGFPDYEEDSQSEQETSVLHHTPTDFHAHEFEVFATELPDINVTP
FT                   SIKPIDIDNNCEHENRLVSEEESKGVISSVPENENLPAVKSNPSSNSISDMLEIRQENK
FT                   LDETLNMIDHQLSSNKSIDSVKTVSDNNISKSANDGSVEDVADSGKETSDIARNIEESH
FT                   NSLINLTSGNNFDQSMHNDLIEESNTRVNVTESDITASEDSFNGSHDQNSSLNNLTKND
FT                   NGIQQNLEDNHTGIQPEMVVPEEVTTTLPEVNILPASENMLENTSESEISVQFLQNRDN
FT                   EDKVSSDPQLEENIRSTETVMNTQETFEPKPAKKNQYTDREIEVLNSQKDISEATDNSA
FT                   VNSRISSSASNFTPVLPPLPKLEKLSIDDPFDDEFETSNESMQMKNSVKPTDYLSIWHL
FT                   QEQTTKAVSPALSSNSQFSYNSNSTKSSVASPVPATAFKFKPKIVSRSKYYYPDNNIQQ
FT                   EQSMDFIYTKLPSILDPMRRNTINSKKIRQTVIDKRKSHPSFSVDEGNTITEVNIEPEV
FT                   KVQPISIENDSSSLKANNQDDNESCSSGSQAFVTPSATMDNFDSQFNELGTSFENDLEN
FT                   VLNYFDKDINTNTSSDLIEETTTKNQALPTSKVWSESVDYSLPTGEEPNVDHNIMKKLL
FT                   NTENSELNECRSDQEHHIIDNAGLGIWRSTANDIATGNVDMFALNGRDISISKSEMTND
FT                   IDMGIFSDKKSLVHTPELSPVKSTHVGSPFKVISPKKNTQKDLKDGTTAEKRVSSESEA
FT                   AQISIMSAVGEITNKDTAVVDDASNKDNIDAGQVGNEGEPIVDKGLLYLHLQGTTKLSL
FT                   AGINAHHPKYSIEFDNGKNVVRTDWTELDSRGTISLNKEFEIPIDQSINKLIITLMIKY
FT                   TRLTNELVEVTKRIPIGKKFPFGKMKYRTETQFVERSTVKDEWDYLFARDGSFGRCEIL
FT                   LDESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKVTQEALYDLPRRPAYKVGSLKVKGC
FT                   FLERVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGYLLQEGGDLSSQMKNRFFKLNGVE
FT                   LVGYHEVSMKPKIRINMLKVVKVIGKDDVVTGKDNVRNFTTWVLMNDCFQLVFDDGEVI
FT                   TFSDESSLADEQSWYMKLKEVVELNAFHQPWVKRFSENMIINDI"
     MEAETTVDSL LKEIDMEMEM QSGNDVAQSN GYLLPLQEIG DETMDMLVQY NTENNANSNV        60
     NANANANANQ WNKVDDPQDL LPMENNYDDD EEQGDESDTT NLLSGNKHLT EEESEQVLVD       120
     SKNLVLPPSS SKSNLINNLK QVVEDEVSDS QLSNDMDDTR TLNFSVKGTE PLLADELQDK       180
     EPDMIEVSTI YDGPDMISMA DDSDTEDIDL LSKAKKPVSP SKIPITNAQT INYFKDAPVE       240
     DAKLQTVPDD IPLETKQTTV SNDILSNVET LLPPTLERPS FVISNLKEAS QSVENLGFPD       300
     YEEDSQSEQE TSVLHHTPTD FHAHEFEVFA TELPDINVTP SIKPIDIDNN CEHENRLVSE       360
     EESKGVISSV PENENLPAVK SNPSSNSISD MLEIRQENKL DETLNMIDHQ LSSNKSIDSV       420
     KTVSDNNISK SANDGSVEDV ADSGKETSDI ARNIEESHNS LINLTSGNNF DQSMHNDLIE       480
     ESNTRVNVTE SDITASEDSF NGSHDQNSSL NNLTKNDNGI QQNLEDNHTG IQPEMVVPEE       540
     VTTTLPEVNI LPASENMLEN TSESEISVQF LQNRDNEDKV SSDPQLEENI RSTETVMNTQ       600
     ETFEPKPAKK NQYTDREIEV LNSQKDISEA TDNSAVNSRI SSSASNFTPV LPPLPKLEKL       660
     SIDDPFDDEF ETSNESMQMK NSVKPTDYLS IWHLQEQTTK AVSPALSSNS QFSYNSNSTK       720
     SSVASPVPAT AFKFKPKIVS RSKYYYPDNN IQQEQSMDFI YTKLPSILDP MRRNTINSKK       780
     IRQTVIDKRK SHPSFSVDEG NTITEVNIEP EVKVQPISIE NDSSSLKANN QDDNESCSSG       840
     SQAFVTPSAT MDNFDSQFNE LGTSFENDLE NVLNYFDKDI NTNTSSDLIE ETTTKNQALP       900
     TSKVWSESVD YSLPTGEEPN VDHNIMKKLL NTENSELNEC RSDQEHHIID NAGLGIWRST       960
     ANDIATGNVD MFALNGRDIS ISKSEMTNDI DMGIFSDKKS LVHTPELSPV KSTHVGSPFK      1020
     VISPKKNTQK DLKDGTTAEK RVSSESEAAQ ISIMSAVGEI TNKDTAVVDD ASNKDNIDAG      1080
     QVGNEGEPIV DKGLLYLHLQ GTTKLSLAGI NAHHPKYSIE FDNGKNVVRT DWTELDSRGT      1140
     ISLNKEFEIP IDQSINKLII TLMIKYTRLT NELVEVTKRI PIGKKFPFGK MKYRTETQFV      1200
     ERSTVKDEWD YLFARDGSFG RCEILLDESL FEKIRFKEQD LSFDLLNKWS RLQNNSSSKV      1260
     TQEALYDLPR RPAYKVGSLK VKGCFLERVS NDEKFPVSLK KAKSIVEKYR SQQDITKEGY      1320
     LLQEGGDLSS QMKNRFFKLN GVELVGYHEV SMKPKIRINM LKVVKVIGKD DVVTGKDNVR      1380
     NFTTWVLMND CFQLVFDDGE VITFSDESSL ADEQSWYMKL KEVVELNAFH QPWVKRFSEN      1440
     MIINDI                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page