(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE396

CAGLA1_12.PE396      Location/Qualifiers
FT   CDS             910473..913802
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440091"
FT                   /locus_tag="CAGL0M09108g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG62717.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG060044"
FT                   /db_xref="HOGENOM:HBG203961"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B7162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ53"
FT                   /transl_table=1
FT                   /translation="MEKKFTNIPEVIDPGITIPIFEEDVDAMSLEQPQKLGSYRARAGK
FT                   FSNTLSNLLPSISAKLHHSKKQGKGAGADPNASTPDSSESAIGNLSAKSSQMFMMNTDQ
FT                   GMPSMTAAVAADMGPPRPAHVEGFSARGAAQDNTTPPRDADKLVHFPESTEYLISRPRT
FT                   SNDSFGNNLPRQISRTRNNTMSSQITSISSIVPKPLPNTVWNNNDTVNQQYQQQQQQQQ
FT                   QQQQQMVPQINTYNAMDMGQQPNYGDTMNQQMGGNNLTVNNAWNSNRPRSHSNASSIYT
FT                   DAPQYDTVGRSRAASSYAHGNSNIPLVADEVDPRSLNWVTTDLLVPPINQISNLLPTNT
FT                   ISISNVFPLQQQQPHLNNAINLTSASLATLCSKYGEVISARTLRGINMALVEFDSVDSA
FT                   IRALDALQGKEVSMIGAPSKVSFAKILPMHYQQSNHTQQQNAQTTQAESVSQPLLQEQL
FT                   NNGAVTFHQQGNISIPVFNQNQYSNGQNTNNNASSHPGTSSSSDKEQCPFPLPPPPLSG
FT                   KKSELEQVVLQFNSDHDESQVASLINNSLKTKPTSDVNNFGPLPGSVSNKQFDAPKLRE
FT                   LRKAIDSNSLSDIEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTG
FT                   KYLASMGVHKNGTWACQKIITKATTPRQIKLVTDGIKDYCTALFNDQFGNYVIQCVLKF
FT                   GYPWNSFIFESILSNFWTIVQNRYGARAVRACLEAHDIVTMEQTLVLSAMIVIYAEYLT
FT                   TNSNGTLLVTWFLDTCVLSNRHSILAPRLVNHIVDLCRHRLASLTILKILNYRGDDAAR
FT                   KTILNTVFGNCETDEPQQILYQILCDVNYGPTFVYKVLSMPLLEDDIRIHIIAQVRKIL
FT                   MESNTAQHHRRLMEEVGLMTTGNNNNQTSNNKHRKNSSHTYVQDNNGHMRGVSVSSVRS
FT                   GGSRQTGLTPNIPQTFQMPSLPNTSMSTVVSGNMSLNQLPTQMQQQQQSGVLPQTVQQQ
FT                   QQQPMVGSNQNNAMSYMNYPGVFPMGYPNNNSSYGINDDLVSKLDMLTLGNGTHLSLPQ
FT                   LSVTNHENNTNYSNNNNNNNNNNNNNNNSNGNNNTNGGNPMNLMNSSLNNTQEFGGSSL
FT                   WN"
     MEKKFTNIPE VIDPGITIPI FEEDVDAMSL EQPQKLGSYR ARAGKFSNTL SNLLPSISAK        60
     LHHSKKQGKG AGADPNASTP DSSESAIGNL SAKSSQMFMM NTDQGMPSMT AAVAADMGPP       120
     RPAHVEGFSA RGAAQDNTTP PRDADKLVHF PESTEYLISR PRTSNDSFGN NLPRQISRTR       180
     NNTMSSQITS ISSIVPKPLP NTVWNNNDTV NQQYQQQQQQ QQQQQQQMVP QINTYNAMDM       240
     GQQPNYGDTM NQQMGGNNLT VNNAWNSNRP RSHSNASSIY TDAPQYDTVG RSRAASSYAH       300
     GNSNIPLVAD EVDPRSLNWV TTDLLVPPIN QISNLLPTNT ISISNVFPLQ QQQPHLNNAI       360
     NLTSASLATL CSKYGEVISA RTLRGINMAL VEFDSVDSAI RALDALQGKE VSMIGAPSKV       420
     SFAKILPMHY QQSNHTQQQN AQTTQAESVS QPLLQEQLNN GAVTFHQQGN ISIPVFNQNQ       480
     YSNGQNTNNN ASSHPGTSSS SDKEQCPFPL PPPPLSGKKS ELEQVVLQFN SDHDESQVAS       540
     LINNSLKTKP TSDVNNFGPL PGSVSNKQFD APKLRELRKA IDSNSLSDIE IEQLAIAMLD       600
     ELPELSSDYL GNTIVQKLFE HSSDIIKDIM LRKTGKYLAS MGVHKNGTWA CQKIITKATT       660
     PRQIKLVTDG IKDYCTALFN DQFGNYVIQC VLKFGYPWNS FIFESILSNF WTIVQNRYGA       720
     RAVRACLEAH DIVTMEQTLV LSAMIVIYAE YLTTNSNGTL LVTWFLDTCV LSNRHSILAP       780
     RLVNHIVDLC RHRLASLTIL KILNYRGDDA ARKTILNTVF GNCETDEPQQ ILYQILCDVN       840
     YGPTFVYKVL SMPLLEDDIR IHIIAQVRKI LMESNTAQHH RRLMEEVGLM TTGNNNNQTS       900
     NNKHRKNSSH TYVQDNNGHM RGVSVSSVRS GGSRQTGLTP NIPQTFQMPS LPNTSMSTVV       960
     SGNMSLNQLP TQMQQQQQSG VLPQTVQQQQ QQPMVGSNQN NAMSYMNYPG VFPMGYPNNN      1020
     SSYGINDDLV SKLDMLTLGN GTHLSLPQLS VTNHENNTNY SNNNNNNNNN NNNNNNSNGN      1080
     NNTNGGNPMN LMNSSLNNTQ EFGGSSLWN                                        1109
//

If you have problems or comments...

PBIL Back to PBIL home page