(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE397

CAGLA1_12.PE397      Location/Qualifiers
FT   CDS             914811..918188
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045133"
FT                   /locus_tag="CAGL0M09130g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62718.1"
FT                   /db_xref="HOGENOM:HBG059230"
FT                   /db_xref="HOGENOM:HBG202254"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="UniParc:UPI00003B7163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ52"
FT                   /transl_table=1
FT                   /translation="MDITNQNHSIDTPMPDTRPDIEFGFGYNAGTTRGGPSLASMQIQQ
FT                   GTNTHHQINNDISFNIGNNDTNSNDTNENIHVDSLRNNGNIQRFTAGDRLPNTIGNQSV
FT                   AMARSIPGSIESRNGFPQDGEALMDMSNVESIDYNAPAKIFADMDINRLFYDPNLSSLQ
FT                   AEDIIKLHNFKEVVHRKIENFIEVIQKRRERILKEIELGNQRLEGVDLETSVSAMTYLN
FT                   KLQRIRISALKSETMELQNLRIQIVSIVDEYKKAMAEYSKLNQEGRNAVNPTPYFQRWI
FT                   KSLNPEDISGLNKELIELQMYSKQLSDIPELASIEYQVSTPQTSQFPLRSLPSEILHLV
FT                   LDKITQKADIVNLLRVCKLWALIIVKILYYRPHINRKHQLDLFMRTMKLTKDETVFDYR
FT                   SMIKRLNFSFVGDHLHDEELYNFVGCRNLERLTLVFCKHITSDPVAAVLKGCKYLQSVD
FT                   ITGIKEIYDNVFDTLAESCKRVQGFYVPQAKLVSYNALTNFVSNAPMLKRIKVTANANV
FT                   NDEFLDLLAEKCPLLVEVDITLSANVHDSSLTKLFMKLTQLREFRITHNANVTDKFFLD
FT                   LSKNVNQLPSLRLLDLSGCENITDKTIDRVVQLSPKLRNIFLGKCSRITDLSLFHLSTL
FT                   GKNLQTVHFGHCFNITDRGVRALIKSCPRIQYVDFACCTNLTNHTLYELSYLSRLKRIG
FT                   LVKCSQMTDDGLLNMIALRGRNDSLERVHFSYCSNLTIYPIYELLMACPRLSHLSLTAV
FT                   PSFLRPDITAFCRPAPSDFSDNQRQIFCVFSGKGVHKLRHYLMSLTTPTDGPQIDVGDT
FT                   LEQYVISKHLLRPGEYLNDGIRRITSELNQDSAAILAATGLNQMNGMNSDFPFQNIDFE
FT                   RLDEVFNWINMSMDGHSLNSDELNDLISEVDRDFCDDPFDEDYNSRDSIVAPGANTGLN
FT                   SELCHIVKKFHRLDDQICDFEVNVSSLARVQFQFTGFLLHEMAQAYMNMVEINRQIWHI
FT                   QKTTLEAGVESDIKALLVWRILFIDKFTALLHKYQISTVVLRLYLKDSITLLTRQRELF
FT                   LAHQRTPWNPTIVEEAPDSNYWQLVGDRIQLLPEQMRVMPFGLRNPAIANNAQQNAAEA
FT                   QNDDRSETPEDDVAIEDF"
     MDITNQNHSI DTPMPDTRPD IEFGFGYNAG TTRGGPSLAS MQIQQGTNTH HQINNDISFN        60
     IGNNDTNSND TNENIHVDSL RNNGNIQRFT AGDRLPNTIG NQSVAMARSI PGSIESRNGF       120
     PQDGEALMDM SNVESIDYNA PAKIFADMDI NRLFYDPNLS SLQAEDIIKL HNFKEVVHRK       180
     IENFIEVIQK RRERILKEIE LGNQRLEGVD LETSVSAMTY LNKLQRIRIS ALKSETMELQ       240
     NLRIQIVSIV DEYKKAMAEY SKLNQEGRNA VNPTPYFQRW IKSLNPEDIS GLNKELIELQ       300
     MYSKQLSDIP ELASIEYQVS TPQTSQFPLR SLPSEILHLV LDKITQKADI VNLLRVCKLW       360
     ALIIVKILYY RPHINRKHQL DLFMRTMKLT KDETVFDYRS MIKRLNFSFV GDHLHDEELY       420
     NFVGCRNLER LTLVFCKHIT SDPVAAVLKG CKYLQSVDIT GIKEIYDNVF DTLAESCKRV       480
     QGFYVPQAKL VSYNALTNFV SNAPMLKRIK VTANANVNDE FLDLLAEKCP LLVEVDITLS       540
     ANVHDSSLTK LFMKLTQLRE FRITHNANVT DKFFLDLSKN VNQLPSLRLL DLSGCENITD       600
     KTIDRVVQLS PKLRNIFLGK CSRITDLSLF HLSTLGKNLQ TVHFGHCFNI TDRGVRALIK       660
     SCPRIQYVDF ACCTNLTNHT LYELSYLSRL KRIGLVKCSQ MTDDGLLNMI ALRGRNDSLE       720
     RVHFSYCSNL TIYPIYELLM ACPRLSHLSL TAVPSFLRPD ITAFCRPAPS DFSDNQRQIF       780
     CVFSGKGVHK LRHYLMSLTT PTDGPQIDVG DTLEQYVISK HLLRPGEYLN DGIRRITSEL       840
     NQDSAAILAA TGLNQMNGMN SDFPFQNIDF ERLDEVFNWI NMSMDGHSLN SDELNDLISE       900
     VDRDFCDDPF DEDYNSRDSI VAPGANTGLN SELCHIVKKF HRLDDQICDF EVNVSSLARV       960
     QFQFTGFLLH EMAQAYMNMV EINRQIWHIQ KTTLEAGVES DIKALLVWRI LFIDKFTALL      1020
     HKYQISTVVL RLYLKDSITL LTRQRELFLA HQRTPWNPTI VEEAPDSNYW QLVGDRIQLL      1080
     PEQMRVMPFG LRNPAIANNA QQNAAEAQND DRSETPEDDV AIEDF                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page