(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE399

CAGLA1_12.PE399      Location/Qualifiers
FT   CDS             complement(922042..922308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210889" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349526"
FT                   /locus_tag="CAGL0M09207g"
FT                   /product="Guanine nucleotide-binding protein subunit gamma "
FT                   /function="signal transducer activity"
FT                   /biological_process="G-protein coupled receptor protein
FT                   signaling pathway"
FT                   /cellular_component="heterotrimeric G-protein complex "
FT                   /protein_id="CAG62722.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005834"
FT                   /db_xref="GO:0007186"
FT                   /db_xref="HOGENOM:HBG058451"
FT                   /db_xref="HOGENOM:HBG397684"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="UniParc:UPI00003B7165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ50"
FT                   /transl_table=1
FT                   /translation="MEVSQSQLDLKIKYLKLKRINELNDKLRDELQRERITASNACLQL
FT                   IAYTTSTRDYALPTLWGYPPADTNHFRDFQTQHADDATCCTIM"
     MEVSQSQLDL KIKYLKLKRI NELNDKLRDE LQRERITASN ACLQLIAYTT STRDYALPTL        60
     WGYPPADTNH FRDFQTQHAD DATCCTIM                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page