(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE4

CAGLA1_12.PE4        Location/Qualifiers
FT   CDS             complement(26473..27207)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044074"
FT                   /gene_name="MGM101"
FT                   /locus_tag="CAGL0M00198g"
FT                   /product="Mitochondrial genome maintenance protein MGM101 "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="mitochondrial genome maintenance "
FT                   /cellular_component="mitochondrial chromosome"
FT                   /protein_id="CAG62329.1"
FT                   /db_xref="GO:0000002"
FT                   /db_xref="GO:0000262"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG192030"
FT                   /db_xref="HOGENOM:HBG448424"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniParc:UPI00003B6FE4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK91"
FT                   /transl_table=1
FT                   /translation="MQRLLKFSGHGSRALFLARRWNSNIASGTAGTFQTTAKPLRSVKP
FT                   TEAALALNGKFLESTNGNENGITSMGSIDWYTSWHGLGSKPFDATVQKALALPLEPTDI
FT                   EIKPDGLIYLPEIKYRRILNRAFGAGGWGLVPRSQTIVTSKLVTREYGLVCHGQLVSVS
FT                   RGEQDYFSETGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKRFKTEHCVEKFVTHI
FT                   ATSKKKKIWIRKDRSVEYPYKA"
     MQRLLKFSGH GSRALFLARR WNSNIASGTA GTFQTTAKPL RSVKPTEAAL ALNGKFLEST        60
     NGNENGITSM GSIDWYTSWH GLGSKPFDAT VQKALALPLE PTDIEIKPDG LIYLPEIKYR       120
     RILNRAFGAG GWGLVPRSQT IVTSKLVTRE YGLVCHGQLV SVSRGEQDYF SETGIPTATE       180
     GCKSNALMRC CKDLGIGSEL WDPVFIKRFK TEHCVEKFVT HIATSKKKKI WIRKDRSVEY       240
     PYKA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page