(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE40

CAGLA1_12.PE40       Location/Qualifiers
FT   CDS             107989..109311
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436696"
FT                   /gene_name="ATG23"
FT                   /locus_tag="CAGL0M00968g"
FT                   /product="Autophagy-related protein 23 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62364.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124118"
FT                   /db_xref="UniParc:UPI00003B7007"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK56"
FT                   /transl_table=1
FT                   /translation="MLNDILVEVAEKTQLLESLIIPHERALTESDYSDQLENIRAEISA
FT                   TLNSLSNLNDLLISHDGPLRTEISSLMASKSKLKKINMKELTLLNEQETLETLRNDSSN
FT                   LESSRPGFTTQQQQSITIASSYRHELQKYLDLVDVEKTSLNTNKLADNSKISKEDVENS
FT                   DFNFNLKRYEKQQSILHSALTVNEIEIKKLETLLKEFRKDNNFIRDELKLINSNLKSHE
FT                   DLISDELKQIDESRYAIMQSIGYSGRNEQQSSILDSIVKLSIKKPDIRTLIQERIEEYS
FT                   NLLNFIDMKLNGLDQMLQEYKSRKSEWAEKSILWSQCLALISELEVTVRDQLSSAHTVG
FT                   SEISPDQIKAQIKKFLTKLNKLLDESDLEDVVYSLVRNEVNSLNVALDEMNQMPQIKND
FT                   ISDRESIHNPSFKLISKSPPKTGFSSENVSYKLNNTNIKKD"
     MLNDILVEVA EKTQLLESLI IPHERALTES DYSDQLENIR AEISATLNSL SNLNDLLISH        60
     DGPLRTEISS LMASKSKLKK INMKELTLLN EQETLETLRN DSSNLESSRP GFTTQQQQSI       120
     TIASSYRHEL QKYLDLVDVE KTSLNTNKLA DNSKISKEDV ENSDFNFNLK RYEKQQSILH       180
     SALTVNEIEI KKLETLLKEF RKDNNFIRDE LKLINSNLKS HEDLISDELK QIDESRYAIM       240
     QSIGYSGRNE QQSSILDSIV KLSIKKPDIR TLIQERIEEY SNLLNFIDMK LNGLDQMLQE       300
     YKSRKSEWAE KSILWSQCLA LISELEVTVR DQLSSAHTVG SEISPDQIKA QIKKFLTKLN       360
     KLLDESDLED VVYSLVRNEV NSLNVALDEM NQMPQIKNDI SDRESIHNPS FKLISKSPPK       420
     TGFSSENVSY KLNNTNIKKD                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page