(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE401

CAGLA1_12.PE401      Location/Qualifiers
FT   CDS             complement(923094..924443)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045134"
FT                   /gene_name="CSN12"
FT                   /locus_tag="CAGL0M09251g"
FT                   /product="COP9 signalosome complex subunit 12 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="CAG62724.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG124119"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI00003B7167"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ48"
FT                   /transl_table=1
FT                   /translation="MEYSRFVDCFERRSYTAEFLEFVGFKLSSEPLGATALILGGSQAK
FT                   QARYGDVNALYDAIVQIKLKESLTSLRELDPNAAVKKNKQRKVHQRVVDVFQALTNELR
FT                   ILNKILERSDDSVWLVYPVYTVCHDVSTFLRDTGKYMQLESRKQLWEECIRVIHRSFMI
FT                   CLNDKNPNMQENKRGGCILFANLEMMFYKMLRNRDMMKNLIKVLESTGMTDISRQRDNK
FT                   VLKRHRSQKIIFNYFIGEYYGCYLFQFNKAQEHLQVCVSEFPVKYTSSKWFKRIIHLYT
FT                   QFRMLATSNKLIHVELPRETNEKFANAYDSDLMNKCYKNGDTIVFDELIKEHAAQYLID
FT                   GTYSAMLLIKELVFLRLVKVCYKVNDKKSILPLDLIAAGYRIHFRNHDNEENRVTTTNP
FT                   RKLQKKNEDLLDELECRIANLIANGRIKGYLSHSQRCMVLSKTEPFPLAS"
     MEYSRFVDCF ERRSYTAEFL EFVGFKLSSE PLGATALILG GSQAKQARYG DVNALYDAIV        60
     QIKLKESLTS LRELDPNAAV KKNKQRKVHQ RVVDVFQALT NELRILNKIL ERSDDSVWLV       120
     YPVYTVCHDV STFLRDTGKY MQLESRKQLW EECIRVIHRS FMICLNDKNP NMQENKRGGC       180
     ILFANLEMMF YKMLRNRDMM KNLIKVLEST GMTDISRQRD NKVLKRHRSQ KIIFNYFIGE       240
     YYGCYLFQFN KAQEHLQVCV SEFPVKYTSS KWFKRIIHLY TQFRMLATSN KLIHVELPRE       300
     TNEKFANAYD SDLMNKCYKN GDTIVFDELI KEHAAQYLID GTYSAMLLIK ELVFLRLVKV       360
     CYKVNDKKSI LPLDLIAAGY RIHFRNHDNE ENRVTTTNPR KLQKKNEDLL DELECRIANL       420
     IANGRIKGYL SHSQRCMVLS KTEPFPLAS                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page