(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE403

CAGLA1_12.PE403      Location/Qualifiers
FT   CDS             925881..926156
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440093"
FT                   /gene_name="EAF6"
FT                   /locus_tag="CAGL0M09295g"
FT                   /product="Chromatin modification-related protein EAF6 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62726.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058457"
FT                   /db_xref="HOGENOM:HBG202249"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniParc:UPI00003B7169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ46"
FT                   /transl_table=1
FT                   /translation="MSDEYQSVKQELKALLADRKELEDKLDKLQQEIYDKESEYFDVDG
FT                   GSKSYHNILRGFDGMSRTQSNNSNMTNNDRIFSLSSASYVKQVQDQ"
     MSDEYQSVKQ ELKALLADRK ELEDKLDKLQ QEIYDKESEY FDVDGGSKSY HNILRGFDGM        60
     SRTQSNNSNM TNNDRIFSLS SASYVKQVQD Q                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page