(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE406

CAGLA1_12.PE406      Location/Qualifiers
FT   CDS             complement(928484..931918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440096"
FT                   /locus_tag="CAGL0M09361g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62729.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG055849"
FT                   /db_xref="HOGENOM:HBG396709"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000861"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR015745"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00003B716C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ43"
FT                   /transl_table=1
FT                   /translation="MLSQVEQDIRRKIAVEENIIKGSSALKKKTDNVMVIQKCNTNIRE
FT                   ARQNIEYLEETLKKLQLSQSQQGQTDSQQQQANDDSTVTEIDRGQGYRQLSTIAPEEHV
FT                   FSRLDLVKYDCPSLAQKIQYMLQQLEFKLQVERQYQEANNKLTKLYQIDGDQRSSSAAE
FT                   GGALESKNRVQLLKKALKKYQAINVDLDQYYKHHNDESLKDMQPKLREKQLTGMLTIGI
FT                   TAIRDVDHIQSPLFARNPETFITVKIDDVVKSRTKPSRNDRWNEEFSIEVDKGNEIEIT
FT                   IYDRVNESVTPVAVMWLLLSDIAEEIRKKKVGKTNGQGWVRAASIKSQTVHNSQAVANR
FT                   TYASDSRTTSLNNSNSDLNQDMSLSPTQVTTNAWFVLEPAGQILLTLGFHKTSQHQRKN
FT                   LVGGLHRHGAIINRKEEVYEQHGHHFVQKSFYNIMCCAYCGDFLRYTGFQCQDCKFLCH
FT                   KKCYGNVVTKCISKASTETDPSEAKLNHHIPHRFEPVSNRGTKWCCHCGYILPWGKQKV
FT                   RKCTECGIMCHTQCAHLVPDFCGMSMEMANKILKTIEDTKRTQEKKKRKPPQTNASALT
FT                   STSTMIGSSVHDRLDSSPSKSMNASIPSIPSPRKHPYAANQYHEKAEEHQMQNQNRLNN
FT                   YIEDNEAYLKFTSGVGVPGASQDVKAQNMNDAYVDQYGHEYQQDNNDSQLKASEDELEL
FT                   WKQHRERMERELQQEQQMQMSYDNNAEGQIDLYTKQASGDVNMLPAVDETVSSHNNPFR
FT                   DMNHETFEQTQNYVANQLQGDVTDIRSSTEIITAAGNNVSPQKRSSGKHKKRGSKRPKV
FT                   SLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLL
FT                   ATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLAL
FT                   KFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELL
FT                   REQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIF
FT                   QGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDTSYFE
FT                   QEFTSAPPSLTPLPSVLSTTQQEEFRGFSYMPEDLEL"
     MLSQVEQDIR RKIAVEENII KGSSALKKKT DNVMVIQKCN TNIREARQNI EYLEETLKKL        60
     QLSQSQQGQT DSQQQQANDD STVTEIDRGQ GYRQLSTIAP EEHVFSRLDL VKYDCPSLAQ       120
     KIQYMLQQLE FKLQVERQYQ EANNKLTKLY QIDGDQRSSS AAEGGALESK NRVQLLKKAL       180
     KKYQAINVDL DQYYKHHNDE SLKDMQPKLR EKQLTGMLTI GITAIRDVDH IQSPLFARNP       240
     ETFITVKIDD VVKSRTKPSR NDRWNEEFSI EVDKGNEIEI TIYDRVNESV TPVAVMWLLL       300
     SDIAEEIRKK KVGKTNGQGW VRAASIKSQT VHNSQAVANR TYASDSRTTS LNNSNSDLNQ       360
     DMSLSPTQVT TNAWFVLEPA GQILLTLGFH KTSQHQRKNL VGGLHRHGAI INRKEEVYEQ       420
     HGHHFVQKSF YNIMCCAYCG DFLRYTGFQC QDCKFLCHKK CYGNVVTKCI SKASTETDPS       480
     EAKLNHHIPH RFEPVSNRGT KWCCHCGYIL PWGKQKVRKC TECGIMCHTQ CAHLVPDFCG       540
     MSMEMANKIL KTIEDTKRTQ EKKKRKPPQT NASALTSTST MIGSSVHDRL DSSPSKSMNA       600
     SIPSIPSPRK HPYAANQYHE KAEEHQMQNQ NRLNNYIEDN EAYLKFTSGV GVPGASQDVK       660
     AQNMNDAYVD QYGHEYQQDN NDSQLKASED ELELWKQHRE RMERELQQEQ QMQMSYDNNA       720
     EGQIDLYTKQ ASGDVNMLPA VDETVSSHNN PFRDMNHETF EQTQNYVANQ LQGDVTDIRS       780
     STEIITAAGN NVSPQKRSSG KHKKRGSKRP KVSLDNFVLL KVLGKGNFGK VILSRSKNTN       840
     RLCAIKVLKK DNIIQNHDIE SARAEKKVFL LATKTKHPFL TNLYCSFQTE NRIYFAMEFI       900
     GGGDLMWHVQ NQRLSVRRAK FYAAEVLLAL KFFHDNGVIY RDLKLENILL TPEGHIKIAD       960
     YGLCKDGMWY GNKTSTFCGT PEFMAPELLR EQDYTKAVDW WAFGVLLYQM LLCQSPFSGD      1020
     DEDEVFNAIL TDEPLYPIDM AGDIVQIFQG LLTKDPEKRL GAGPRDALEI MEEPFFRNIN      1080
     FDDLLNLRIK PPYIPEIKSA EDTSYFEQEF TSAPPSLTPL PSVLSTTQQE EFRGFSYMPE      1140
     DLEL                                                                   1144
//

If you have problems or comments...

PBIL Back to PBIL home page