(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE408

CAGLA1_12.PE408      Location/Qualifiers
FT   CDS             complement(935685..937040)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440098"
FT                   /locus_tag="CAGL0M09405g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62731.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG124122"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003B716E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ41"
FT                   /transl_table=1
FT                   /translation="MEINNEDHELLAEIMGHGGDGSELFGNDADVFLRNGSGSGETQAG
FT                   NADGLALYPQATPAHRHEQMAMMNHGNSEMHSFLDDMFTNSSLGHGQPVTESNLTKNMM
FT                   GNHYEQNLESDIASSLYNSRHPSVSMEHGTAGHPEMLFHQNDNSISSFSESFYGSSLDS
FT                   SISEVSSINSFMSGNSFPAPLPHQIDENSILVNNNMSPSGFRDSIRPGSFLSTSLRAPS
FT                   SMSRQMRNPSYNDSGIPMTVGSVPKNATSHMTPDEKLKRKREFHNAVERRRRELIKQKI
FT                   KELSKLVPPSLLNYDADGNQIKSNRGTILDKSVEYLEYLLYVIDIQKRKREALQEKIAQ
FT                   LSSLSSRTTDDLGMGPRKMTNLPQRISSQATLKANTFNEEKIIDTRGIPDTRGISASQA
FT                   HTDNPLEDFNHNHVDFNATHTDFNNNINDDLQQFLSGDLMEAEDNAKLMFNP"
     MEINNEDHEL LAEIMGHGGD GSELFGNDAD VFLRNGSGSG ETQAGNADGL ALYPQATPAH        60
     RHEQMAMMNH GNSEMHSFLD DMFTNSSLGH GQPVTESNLT KNMMGNHYEQ NLESDIASSL       120
     YNSRHPSVSM EHGTAGHPEM LFHQNDNSIS SFSESFYGSS LDSSISEVSS INSFMSGNSF       180
     PAPLPHQIDE NSILVNNNMS PSGFRDSIRP GSFLSTSLRA PSSMSRQMRN PSYNDSGIPM       240
     TVGSVPKNAT SHMTPDEKLK RKREFHNAVE RRRRELIKQK IKELSKLVPP SLLNYDADGN       300
     QIKSNRGTIL DKSVEYLEYL LYVIDIQKRK REALQEKIAQ LSSLSSRTTD DLGMGPRKMT       360
     NLPQRISSQA TLKANTFNEE KIIDTRGIPD TRGISASQAH TDNPLEDFNH NHVDFNATHT       420
     DFNNNINDDL QQFLSGDLME AEDNAKLMFN P                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page