(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE409

CAGLA1_12.PE409      Location/Qualifiers
FT   CDS             937627..938268
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440099"
FT                   /locus_tag="CAGL0M09427g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="CAG62732.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG244788"
FT                   /db_xref="HOGENOM:HBG323920"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniParc:UPI00003B716F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ40"
FT                   /transl_table=1
FT                   /translation="MTDNNDQVNLLRDSLSRWNQGRAQQSQGFNESAKTLFSSWADSIN
FT                   ERAQDVYSRLPVSRQDLIQDEEPAWFNLSRTERLILFVCFILGSAACFTLCVFLFPVLA
FT                   IKPRKFGILWSVGSLLFVLAFGIFQGPVAYIKHLTSRERLPFTVFFFGTCALTIYFAAF
FT                   MKSTILTIPCAVLELIAVLYYAISYFPFGGTGLRMLSSFGINTARGALHI"
     MTDNNDQVNL LRDSLSRWNQ GRAQQSQGFN ESAKTLFSSW ADSINERAQD VYSRLPVSRQ        60
     DLIQDEEPAW FNLSRTERLI LFVCFILGSA ACFTLCVFLF PVLAIKPRKF GILWSVGSLL       120
     FVLAFGIFQG PVAYIKHLTS RERLPFTVFF FGTCALTIYF AAFMKSTILT IPCAVLELIA       180
     VLYYAISYFP FGGTGLRMLS SFGINTARGA LHI                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page