(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE41

CAGLA1_12.PE41       Location/Qualifiers
FT   CDS             complement(109609..115548)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436697"
FT                   /locus_tag="CAGL0M00990g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62365.1"
FT                   /db_xref="HOGENOM:HBG059089"
FT                   /db_xref="HOGENOM:HBG396727"
FT                   /db_xref="UniParc:UPI00003B7008"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK55"
FT                   /transl_table=1
FT                   /translation="MSLPIAQLYEKAGQFVPLIEKVYNGSNVGISESKLLGDVLHFIAE
FT                   LKDQHIFCDPQFEPIAVFCLTIFSFNDQSTIDWLKSRFNSILASCNKCVLAFARGKSRM
FT                   LRHFAIQRNVPHEHVAKFNNLICSWRLDTIRVPIEKLSNLPIGSQVENDFSCAFYECMT
FT                   DPNLMRMDRAFRALFDKSFSVLLSSQDSLLNGKTPNDGDILLAGTIFCWCEGNKDENDW
FT                   ARKVLRNLIQSKTTFNMKTIGDDVLDEIQTHFLFLQNPGNWNEVIVSQFWTRFIPIFTM
FT                   LDREIIEEYFGIPKNQESLKRSFKYPIESLVKLWCNHMTKLYSDKPVDFLLRALHMFLD
FT                   KLGQDFWQLIEPYTFHSILDSLFEQPVFLARLMRLQKEPIIENREELIFSFSGSLTDLL
FT                   AWTLPFYNALSPSKRIQMVKKVSISFLKIVAHQPNLESISKACLVTSSCTLLSSVLFIT
FT                   DDERAKLYSVNDFENVLLTKVDSRLLLDNSLIQNVLLKSITEPASFYPGLGNSATSVAA
FT                   STMGVLTTCIDFDLLTLCQRTYKLYFGTAVNEFPLPLSLLENMVGSIQLGSFHNGPLLT
FT                   KLLLTSLKNVYGIVIITKSNLNTTQHNKTVENVWNLVINLVENFNDLLPNQLMEILGDK
FT                   DAMVGFWSCIFSSNEKLYQAATNILYNTFDVDGRLEGVQALFKQNVSSHLNSINFILSK
FT                   LIKCEYFELCPRTVKVLMDIISAFIDPTNGVLSNPEISNSSETKDEMFSFWNLVWSFLD
FT                   SIYRCTLKWATKYNYSLLENFTKDTLDLSNALVGSFREFKDVLGENVNLFHVVLKAFKN
FT                   MLYWLRLSDEILLESCVKLITSTSDLAQERKMKFDDELVELMAKYGSKYRKFSNKLSLQ
FT                   QSNEIISRAQTLNPTLTSKIMDEASAYNKMKEQAKQTIVISDSEETGTGKSPAELKSEY
FT                   LQRKALGLAAHTKSKVTQSKITSFGTVQAGAALSLKTKPQPKPLSKMEMARRQLLQNRV
FT                   IHPPSQPAFHTKAPSKSQTAEDDTSSDESDIDMETARELFAVAKSKSKGIETLDISGKP
FT                   IKINSAAERAKMEEEYMRKRLNVDLNPLYEQLLQWDYTKISEYPDDKGADAYRDIKDEF
FT                   KSANDYKNVMKPLLLLESWQGMCSARDRDENTPFSIVIGNRTSISDFYEIYASISKKML
FT                   QDSNITESDLIVLAYFPNIAPGQKVRYEEFKKAQFTCLAKVKTLKKTKGGNVDMSLRVH
FT                   RNHSFAKYLTHRAEINAVKVMQMTTIEREYSTLEALQYYDLVNQILSAKLSPPSNTFEQ
FT                   QIMKVQQEYFLNESQARAIVNTVISSGFSLIQGPPGTGKTKTILGIVGYFLSLRNATPT
FT                   GTIQAPTDKKSTTLDQMLKKPKILICAPSNAAVDEICLRLKSGIKTKGQTVRPAIIRLG
FT                   RTDVVNAELKDVTLEEIVDKKLGDKSYEFTNNPDIEKKFQSLLSERRQLRDKLNAENGS
FT                   PDSSMSTNDIANLQMKIRELTKSINELGREKDEMREKNAINYRNRDLDRRNAQAQVLAS
FT                   CDIICSTLSGSAHDVLATLGMKFETVVIDEACQCTELSAIIPLRYGSKRCIMVGDPNQL
FT                   PPTVLSGAASNFKYNQSLFVRMEKNSKPFLLDVQYRMHPAISKFPSAEFYDGRLMDGPD
FT                   MESLNKRIWHEQEPFKPYKFFDITSGQQVQNVKTMSYTNKEEIEVAIEMVDKLFRLYDN
FT                   KIDFSNKIGVISPYKEQIQRMRREFMRYFGGSITKFVDFNTIDGFQGQEKEIIIISCVR
FT                   ADDSQSGVGFLKDFRRMNVALTRARTSIWILGHQKSLRKSKLWSHLIDDAEGRGCLQQA
FT                   YSGFLNSSNSRAQDTLNKYKESKSKEKKKHPIPAAADKKDADISNRNISEATDISDGED
FT                   DYDPVTAFKPIEKIAIKRRADNQDKSPFIEKKRIKKPKIQANDENPSGTKKKSSIFGSK
FT                   ENNQVPSKPAVPYIKDKASKKDKKEDKKKSKKSRHISFSDSIETIP"
     MSLPIAQLYE KAGQFVPLIE KVYNGSNVGI SESKLLGDVL HFIAELKDQH IFCDPQFEPI        60
     AVFCLTIFSF NDQSTIDWLK SRFNSILASC NKCVLAFARG KSRMLRHFAI QRNVPHEHVA       120
     KFNNLICSWR LDTIRVPIEK LSNLPIGSQV ENDFSCAFYE CMTDPNLMRM DRAFRALFDK       180
     SFSVLLSSQD SLLNGKTPND GDILLAGTIF CWCEGNKDEN DWARKVLRNL IQSKTTFNMK       240
     TIGDDVLDEI QTHFLFLQNP GNWNEVIVSQ FWTRFIPIFT MLDREIIEEY FGIPKNQESL       300
     KRSFKYPIES LVKLWCNHMT KLYSDKPVDF LLRALHMFLD KLGQDFWQLI EPYTFHSILD       360
     SLFEQPVFLA RLMRLQKEPI IENREELIFS FSGSLTDLLA WTLPFYNALS PSKRIQMVKK       420
     VSISFLKIVA HQPNLESISK ACLVTSSCTL LSSVLFITDD ERAKLYSVND FENVLLTKVD       480
     SRLLLDNSLI QNVLLKSITE PASFYPGLGN SATSVAASTM GVLTTCIDFD LLTLCQRTYK       540
     LYFGTAVNEF PLPLSLLENM VGSIQLGSFH NGPLLTKLLL TSLKNVYGIV IITKSNLNTT       600
     QHNKTVENVW NLVINLVENF NDLLPNQLME ILGDKDAMVG FWSCIFSSNE KLYQAATNIL       660
     YNTFDVDGRL EGVQALFKQN VSSHLNSINF ILSKLIKCEY FELCPRTVKV LMDIISAFID       720
     PTNGVLSNPE ISNSSETKDE MFSFWNLVWS FLDSIYRCTL KWATKYNYSL LENFTKDTLD       780
     LSNALVGSFR EFKDVLGENV NLFHVVLKAF KNMLYWLRLS DEILLESCVK LITSTSDLAQ       840
     ERKMKFDDEL VELMAKYGSK YRKFSNKLSL QQSNEIISRA QTLNPTLTSK IMDEASAYNK       900
     MKEQAKQTIV ISDSEETGTG KSPAELKSEY LQRKALGLAA HTKSKVTQSK ITSFGTVQAG       960
     AALSLKTKPQ PKPLSKMEMA RRQLLQNRVI HPPSQPAFHT KAPSKSQTAE DDTSSDESDI      1020
     DMETARELFA VAKSKSKGIE TLDISGKPIK INSAAERAKM EEEYMRKRLN VDLNPLYEQL      1080
     LQWDYTKISE YPDDKGADAY RDIKDEFKSA NDYKNVMKPL LLLESWQGMC SARDRDENTP      1140
     FSIVIGNRTS ISDFYEIYAS ISKKMLQDSN ITESDLIVLA YFPNIAPGQK VRYEEFKKAQ      1200
     FTCLAKVKTL KKTKGGNVDM SLRVHRNHSF AKYLTHRAEI NAVKVMQMTT IEREYSTLEA      1260
     LQYYDLVNQI LSAKLSPPSN TFEQQIMKVQ QEYFLNESQA RAIVNTVISS GFSLIQGPPG      1320
     TGKTKTILGI VGYFLSLRNA TPTGTIQAPT DKKSTTLDQM LKKPKILICA PSNAAVDEIC      1380
     LRLKSGIKTK GQTVRPAIIR LGRTDVVNAE LKDVTLEEIV DKKLGDKSYE FTNNPDIEKK      1440
     FQSLLSERRQ LRDKLNAENG SPDSSMSTND IANLQMKIRE LTKSINELGR EKDEMREKNA      1500
     INYRNRDLDR RNAQAQVLAS CDIICSTLSG SAHDVLATLG MKFETVVIDE ACQCTELSAI      1560
     IPLRYGSKRC IMVGDPNQLP PTVLSGAASN FKYNQSLFVR MEKNSKPFLL DVQYRMHPAI      1620
     SKFPSAEFYD GRLMDGPDME SLNKRIWHEQ EPFKPYKFFD ITSGQQVQNV KTMSYTNKEE      1680
     IEVAIEMVDK LFRLYDNKID FSNKIGVISP YKEQIQRMRR EFMRYFGGSI TKFVDFNTID      1740
     GFQGQEKEII IISCVRADDS QSGVGFLKDF RRMNVALTRA RTSIWILGHQ KSLRKSKLWS      1800
     HLIDDAEGRG CLQQAYSGFL NSSNSRAQDT LNKYKESKSK EKKKHPIPAA ADKKDADISN      1860
     RNISEATDIS DGEDDYDPVT AFKPIEKIAI KRRADNQDKS PFIEKKRIKK PKIQANDENP      1920
     SGTKKKSSIF GSKENNQVPS KPAVPYIKDK ASKKDKKEDK KKSKKSRHIS FSDSIETIP       1979
//

If you have problems or comments...

PBIL Back to PBIL home page