(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE410

CAGLA1_12.PE410      Location/Qualifiers
FT   CDS             complement(938424..941660)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196348"
FT                   /locus_tag="CAGL0M09449g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62733.1"
FT                   /db_xref="HOGENOM:HBG124123"
FT                   /db_xref="HOGENOM:HBG204118"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniParc:UPI00003B7170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ39"
FT                   /transl_table=1
FT                   /translation="MVSSSSSRRRSSTIKSALSSLLHGHSNGSGHHGKDSAYARRHSTN
FT                   SISANGSDTSVRSKLSSHGTGSAANARVPSRTPNKSSTMPDVQSNSTGHLNDTMRNTRY
FT                   DSTRYSRSFATDDENAIEFDDQNTSLNSDPSGLTPLPESFNKEYLAEYLHNRGFLNPKS
FT                   VETRENFSIGIATSGDVIFLPTVSSNDDEYLARLNGVGSGESNMELDQGAMDDELTGDD
FT                   FVIQDGVLQRQQQNQGHSATDNSSSTAVASPSGTQSDVPDSGAYQNRSLEFDASMVSFS
FT                   VAVILSVKSPIKLTDLKVELSSRVRIYWHAGVPPTKTFFEEFYQAGYVNWNLNDTNYDV
FT                   FVPTTVSSNTQIVERHNNTPTKIFRNKPISERYYTDKSKLKRQYLDSLLDCEGHLLEAG
FT                   DYVYLLPVIFSNHIPESTYLPSARISYKLKIGTRAIGSSIKRAGSTGSSLSIGQQNQPI
FT                   SSHSSTSSLSSLRDMDHEGKANSSASPHKGLSGNLLKKVKNHLHLPHNQVKPGEIEESR
FT                   ELYTEYPIKVIRTPPPISISTANKPIYINRVWSDSLSYEISFASKYVSLNSRVPIKIKL
FT                   APIAKNICVKRVRVSITEKITFVSKNLEYEYDQVDPVAKDPYNPYYLDFTSKRRKERNL
FT                   ALLEVRTKPKGSRALREEIVENCVNDNLLSFGEIKEPGKADSIPLVEPVSIETRLDFPS
FT                   YMDLDKRHAKNIPPYGIDVYTAIANPEEQQSTSHHKSSVIGILTGIKNSTDSGSSPSKA
FT                   NSDKNTNNSSSAETESAARRQTVSRFHQTSIKANSHPNVKFHTRLNKCKRGLYLDSLHY
FT                   TNVHARHKLEVMLRISKPDPENPSKLRHYEVLIDTPVFLVSDQCNTGNMELPTYDMATT
FT                   VTSTDLTPIPNATNLAPPPTFEEAISVPASPFQSPAASPIGSPVMSPSYDPELLSIQQL
FT                   NLSRSTSFSGPSVHLENTNTGTGGSSVGGISLLQPGSSHRPSISAEASSGRYSNLDRLM
FT                   FASSQTSPPPPLPMDIMQGRRASDAAAVSSSYTNPEQSPRIPIIVETNPFFKKDYTLTP
FT                   RSNEPEADDNSTTPGQLPSKDPPTYEEAVS"
     MVSSSSSRRR SSTIKSALSS LLHGHSNGSG HHGKDSAYAR RHSTNSISAN GSDTSVRSKL        60
     SSHGTGSAAN ARVPSRTPNK SSTMPDVQSN STGHLNDTMR NTRYDSTRYS RSFATDDENA       120
     IEFDDQNTSL NSDPSGLTPL PESFNKEYLA EYLHNRGFLN PKSVETRENF SIGIATSGDV       180
     IFLPTVSSND DEYLARLNGV GSGESNMELD QGAMDDELTG DDFVIQDGVL QRQQQNQGHS       240
     ATDNSSSTAV ASPSGTQSDV PDSGAYQNRS LEFDASMVSF SVAVILSVKS PIKLTDLKVE       300
     LSSRVRIYWH AGVPPTKTFF EEFYQAGYVN WNLNDTNYDV FVPTTVSSNT QIVERHNNTP       360
     TKIFRNKPIS ERYYTDKSKL KRQYLDSLLD CEGHLLEAGD YVYLLPVIFS NHIPESTYLP       420
     SARISYKLKI GTRAIGSSIK RAGSTGSSLS IGQQNQPISS HSSTSSLSSL RDMDHEGKAN       480
     SSASPHKGLS GNLLKKVKNH LHLPHNQVKP GEIEESRELY TEYPIKVIRT PPPISISTAN       540
     KPIYINRVWS DSLSYEISFA SKYVSLNSRV PIKIKLAPIA KNICVKRVRV SITEKITFVS       600
     KNLEYEYDQV DPVAKDPYNP YYLDFTSKRR KERNLALLEV RTKPKGSRAL REEIVENCVN       660
     DNLLSFGEIK EPGKADSIPL VEPVSIETRL DFPSYMDLDK RHAKNIPPYG IDVYTAIANP       720
     EEQQSTSHHK SSVIGILTGI KNSTDSGSSP SKANSDKNTN NSSSAETESA ARRQTVSRFH       780
     QTSIKANSHP NVKFHTRLNK CKRGLYLDSL HYTNVHARHK LEVMLRISKP DPENPSKLRH       840
     YEVLIDTPVF LVSDQCNTGN MELPTYDMAT TVTSTDLTPI PNATNLAPPP TFEEAISVPA       900
     SPFQSPAASP IGSPVMSPSY DPELLSIQQL NLSRSTSFSG PSVHLENTNT GTGGSSVGGI       960
     SLLQPGSSHR PSISAEASSG RYSNLDRLMF ASSQTSPPPP LPMDIMQGRR ASDAAAVSSS      1020
     YTNPEQSPRI PIIVETNPFF KKDYTLTPRS NEPEADDNST TPGQLPSKDP PTYEEAVS        1078
//

If you have problems or comments...

PBIL Back to PBIL home page