(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE411

CAGLA1_12.PE411      Location/Qualifiers
FT   CDS             complement(942333..942659)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440100"
FT                   /gene_name="ATG16"
FT                   /locus_tag="CAGL0M09471g"
FT                   /product="Autophagy protein 16 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasmic membrane-bounded vesicle "
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAG62734.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016023"
FT                   /db_xref="HOGENOM:HBG059479"
FT                   /db_xref="HOGENOM:HBG104155"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="UniParc:UPI00003B7171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ38"
FT                   /transl_table=1
FT                   /translation="MLAERDTLEKNYCELFEVPVDGRSNDGDAMLLQEALRGKDNEIRM
FT                   LEERLAVSSKNVERLNDELLGANLEANVLGQKLQDLQQEHDKLLERWMQRVRVEVDKMN
FT                   AQLE"
     MLAERDTLEK NYCELFEVPV DGRSNDGDAM LLQEALRGKD NEIRMLEERL AVSSKNVERL        60
     NDELLGANLE ANVLGQKLQD LQQEHDKLLE RWMQRVRVEV DKMNAQLE                    108
//

If you have problems or comments...

PBIL Back to PBIL home page