(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE413

CAGLA1_12.PE413      Location/Qualifiers
FT   CDS             945440..946045
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045136"
FT                   /gene_name="ROX3"
FT                   /gene_synonym="MED19"
FT                   /locus_tag="CAGL0M09515g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 19"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG62736.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG060115"
FT                   /db_xref="HOGENOM:HBG204148"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniParc:UPI00003B7173"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ36"
FT                   /transl_table=1
FT                   /translation="MEMEEFAPSYYYYVEPEMGYQPQQPNPMEDLITVYHLDDISRQVA
FT                   RTNEDGTKAVKLRKSYKNQITDLSGKFSSIPNRENRKGGEIAHILFQNNPDMMNQVHRS
FT                   PDMTDEQWREALMNVDASLFQAPNMDWEVCQSVLSQFDRSYPTEFQNDPNFHVDDLAFD
FT                   LDGTGKSNAKKRKNRSNGSSMATPNSEMQDDVKRRRLE"
     MEMEEFAPSY YYYVEPEMGY QPQQPNPMED LITVYHLDDI SRQVARTNED GTKAVKLRKS        60
     YKNQITDLSG KFSSIPNREN RKGGEIAHIL FQNNPDMMNQ VHRSPDMTDE QWREALMNVD       120
     ASLFQAPNMD WEVCQSVLSQ FDRSYPTEFQ NDPNFHVDDL AFDLDGTGKS NAKKRKNRSN       180
     GSSMATPNSE MQDDVKRRRL E                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page