(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE415

CAGLA1_12.PE415      Location/Qualifiers
FT   CDS             complement(947542..949797)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196349"
FT                   /locus_tag="CAGL0M09559g"
FT                   /product="Condensin complex subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome condensation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62738.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0030261"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG060118"
FT                   /db_xref="HOGENOM:HBG396937"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniParc:UPI00003B7175"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ34"
FT                   /transl_table=1
FT                   /translation="MLANLEEWIKMATDNKINSRNSWNFALIDYFYDLNILKDSENNIN
FT                   FQKASATLDGCVKIYSSRVDSVTSETGKLLSGLSQRKNEQANSKNNKQPGDGNDGDYDD
FT                   ADSSVQIDALTGLPVGKDSDEYLKRRRVHNRVLETTLVEFDNIRMKELDQELNIDPLFK
FT                   KALVDFDEGGAKSLLLNTLSIDESGRVVFDAAMKNEPSLLKEKESNEEPLNENNLPLDS
FT                   SKSMDEDNSHGDRSDKNSTPTPQTPITEPEEEEDSKADITLNKSFSSNFQYSMDDEILA
FT                   LGIDYIKFDDISTSDISPSLQNLRNVIADINKAKGFIDSINNKFDNFLTEDEIKEAVPE
FT                   EEGPNGNDYDDGINQELEYSMGNNEDVLPFDINDGGDNFGEDNEGGIDDEEGDENGGLD
FT                   SMLGSILEKDLMAYFDEKMNRNWRGREHWKVANYKKANTIDNKSSEPNNEIEREATESE
FT                   GTSEENKKSDTKKERKKQIQIDFLNLDPNIESIVFDSKKRSGIDMAIKSRTNDSHYLLP
FT                   DDYHFSTEKITGLFIKPNTKMSIFNRVKRRKMTAAQVDTTSDNLGNGIPQIADEQFWAN
FT                   NYEEQENENNIGGNNDLESSNIVGADIENPFEEEGIDFNQAFEDMSLDENDDAGKDIFT
FT                   QKDEKEDLTKLRQPDKVTYSRVSKKVDVRRLKKNIWMSVKSVVSQLDETSDILQFRFTD
FT                   ITKNLGKFYSPESLSDISTSFCFICLLHLANEHGLQIKSTENYEDLTVIFDKSVVTV"
     MLANLEEWIK MATDNKINSR NSWNFALIDY FYDLNILKDS ENNINFQKAS ATLDGCVKIY        60
     SSRVDSVTSE TGKLLSGLSQ RKNEQANSKN NKQPGDGNDG DYDDADSSVQ IDALTGLPVG       120
     KDSDEYLKRR RVHNRVLETT LVEFDNIRMK ELDQELNIDP LFKKALVDFD EGGAKSLLLN       180
     TLSIDESGRV VFDAAMKNEP SLLKEKESNE EPLNENNLPL DSSKSMDEDN SHGDRSDKNS       240
     TPTPQTPITE PEEEEDSKAD ITLNKSFSSN FQYSMDDEIL ALGIDYIKFD DISTSDISPS       300
     LQNLRNVIAD INKAKGFIDS INNKFDNFLT EDEIKEAVPE EEGPNGNDYD DGINQELEYS       360
     MGNNEDVLPF DINDGGDNFG EDNEGGIDDE EGDENGGLDS MLGSILEKDL MAYFDEKMNR       420
     NWRGREHWKV ANYKKANTID NKSSEPNNEI EREATESEGT SEENKKSDTK KERKKQIQID       480
     FLNLDPNIES IVFDSKKRSG IDMAIKSRTN DSHYLLPDDY HFSTEKITGL FIKPNTKMSI       540
     FNRVKRRKMT AAQVDTTSDN LGNGIPQIAD EQFWANNYEE QENENNIGGN NDLESSNIVG       600
     ADIENPFEEE GIDFNQAFED MSLDENDDAG KDIFTQKDEK EDLTKLRQPD KVTYSRVSKK       660
     VDVRRLKKNI WMSVKSVVSQ LDETSDILQF RFTDITKNLG KFYSPESLSD ISTSFCFICL       720
     LHLANEHGLQ IKSTENYEDL TVIFDKSVVT V                                      751
//

If you have problems or comments...

PBIL Back to PBIL home page