(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE416

CAGLA1_12.PE416      Location/Qualifiers
FT   CDS             complement(951054..952685)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440102"
FT                   /locus_tag="CAGL0M09581g"
FT                   /product="Similar to uniprot|P07251 Saccharomyces
FT                   cerevisiae YBL099w F1F0-ATPase complex "
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAG62739.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017458"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI00003B7176"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ33"
FT                   /transl_table=1
FT                   /translation="MLSRVVLARNALRAVSRASRASRGSVVRTSARCYAAKAQPTEVSS
FT                   ILEEKIRGVSDEAQLNETGRVLAVGDGIARVFGLNNIQAEELVEFASGVKGMALNLEPG
FT                   QVGIVLFGSDRLVKEGEIVKRTGKIVDVPVGPGLLGRVVDALGNPIDGKGPIESVGTAR
FT                   AQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQK
FT                   RWNDGNDESKKLYCVYVAIGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAPLQYLA
FT                   PFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRL
FT                   LERAAKMSDKEGAGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPA
FT                   INVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGER
FT                   LTQLLKQSQYSPLAAEEQVPLIYAGVNGYLDNIDLGRIAEFESSFLAYLKSNHENILND
FT                   IRDKGELTKDLLATLKSATESFVATF"
     MLSRVVLARN ALRAVSRASR ASRGSVVRTS ARCYAAKAQP TEVSSILEEK IRGVSDEAQL        60
     NETGRVLAVG DGIARVFGLN NIQAEELVEF ASGVKGMALN LEPGQVGIVL FGSDRLVKEG       120
     EIVKRTGKIV DVPVGPGLLG RVVDALGNPI DGKGPIESVG TARAQVKAPG ILPRRSVHEP       180
     VQTGLKAVDA LVPIGRGQRE LIIGDRQTGK TAVALDTILN QKRWNDGNDE SKKLYCVYVA       240
     IGQKRSTVAQ LVQTLEQHDA LKYSIIVAAT ASEAAPLQYL APFTAASIGE WFRDNGKHAL       300
     IVYDDLSKQA VAYRQLSLLL RRPPGREAYP GDVFYLHSRL LERAAKMSDK EGAGSLTALP       360
     VIETQGGDVS AYIPTNVISI TDGQIFLEAE LFYKGIRPAI NVGLSVSRVG SAAQVKALKQ       420
     VAGSLKLFLA QYREVAAFAQ FGSDLDASTK QTLVRGERLT QLLKQSQYSP LAAEEQVPLI       480
     YAGVNGYLDN IDLGRIAEFE SSFLAYLKSN HENILNDIRD KGELTKDLLA TLKSATESFV       540
     ATF                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page