(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE418

CAGLA1_12.PE418      Location/Qualifiers
FT   CDS             955675..956367
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000141874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501705"
FT                   /gene_name="AIM36"
FT                   /gene_synonym="FMP39"
FT                   /locus_tag="CAGL0M09614g"
FT                   /product="Altered inheritance of mitochondria protein 36,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAG62741.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG058833"
FT                   /db_xref="HOGENOM:HBG104148"
FT                   /db_xref="UniParc:UPI00003B7178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ31"
FT                   /transl_table=1
FT                   /translation="MALMRLGLRIPARLGSNLPVAQLGIRAAKHRFYATAPRNDGGELP
FT                   SIKKLLMIGLAGTAVFVLAVNSLDKQQPKNSYSESEFESLQRLKRKVALFPGNQLKVYG
FT                   VLGTEKYNKIVSGGKIVDPRKIIEKHRTTAGDRYEALLNILYDKYGAVEYFDMLPQGLM
FT                   VKLVSLYMKDNCSEGDTVVILDFPKSIKDASQFETEVAGISKFIVSQKLKDTDICKYYD
FT                   AVGKLESV"
     MALMRLGLRI PARLGSNLPV AQLGIRAAKH RFYATAPRND GGELPSIKKL LMIGLAGTAV        60
     FVLAVNSLDK QQPKNSYSES EFESLQRLKR KVALFPGNQL KVYGVLGTEK YNKIVSGGKI       120
     VDPRKIIEKH RTTAGDRYEA LLNILYDKYG AVEYFDMLPQ GLMVKLVSLY MKDNCSEGDT       180
     VVILDFPKSI KDASQFETEV AGISKFIVSQ KLKDTDICKY YDAVGKLESV                  230
//

If you have problems or comments...

PBIL Back to PBIL home page