(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE422

CAGLA1_12.PE422      Location/Qualifiers
FT   CDS             complement(961939..963159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440107"
FT                   /locus_tag="CAGL0M09691g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62745.1"
FT                   /db_xref="HOGENOM:HBG124126"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="UniParc:UPI00003B717C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ27"
FT                   /transl_table=1
FT                   /translation="MFGNSAGFGSVGDNSSGGSGANRDANNRPSWFQETARRTIPNTVL
FT                   RREVKSSSNSGEDDNGNRGDSTSTGFNTLTFGAKKHMLLGSSNVSTGGNDHMNPLLMDN
FT                   SEAPPTVSISDWKREEGLFDLRNTRNENTINTIGTPTFISPISREKSEVSLFDSNSQSR
FT                   SSSASSIGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMRTPGY
FT                   FFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISEL
FT                   SRDTYNSMNDVKQTNSISTNQLTQHNQSEVPKSNQTFETKPTNETERNQIKTPSAFGSD
FT                   NKGNGSISSGRTKRRLSIKDGSSLFLSGTDNIFSTLDGQPTKKRMINRDRSLIGKISGW
FT                   LFGWNDL"
     MFGNSAGFGS VGDNSSGGSG ANRDANNRPS WFQETARRTI PNTVLRREVK SSSNSGEDDN        60
     GNRGDSTSTG FNTLTFGAKK HMLLGSSNVS TGGNDHMNPL LMDNSEAPPT VSISDWKREE       120
     GLFDLRNTRN ENTINTIGTP TFISPISREK SEVSLFDSNS QSRSSSASSI GSESETGNAV       180
     VVFGYREAIT KQILAYFAQF GEILEDLESE LGDTETMRTP GYFFQQAPNR RRISREHGRT       240
     WTKLTYANHS SYLRALREHG TIYCGAAIGC VPYKHELISE LSRDTYNSMN DVKQTNSIST       300
     NQLTQHNQSE VPKSNQTFET KPTNETERNQ IKTPSAFGSD NKGNGSISSG RTKRRLSIKD       360
     GSSLFLSGTD NIFSTLDGQP TKKRMINRDR SLIGKISGWL FGWNDL                      406
//

If you have problems or comments...

PBIL Back to PBIL home page