(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE424

CAGLA1_12.PE424      Location/Qualifiers
FT   CDS             964915..966207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045137"
FT                   /locus_tag="CAGL0M09735g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62747.1"
FT                   /db_xref="HOGENOM:HBG191670"
FT                   /db_xref="HOGENOM:HBG202527"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="UniParc:UPI00003B717E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ25"
FT                   /transl_table=1
FT                   /translation="MKLKLEINGNDYPENFKLLKTTVTTVASLRSLAVLRFDSDRLVII
FT                   STPRVSNGVVAGHGVVARDSGELWCTIPRDVFSLYHVSAERQNNTIALECNVESLKNAV
FT                   LRYDKVMTQGSASTLQLKLRQMPEWNAASANGPDSAGNSRIRVAALAVSFEELVNVYSG
FT                   QGKDDAFMDATQNNTSHAVNKLISHSSKIPVRFLNAQQDERIQEPMMDYNQTMLCRLPS
FT                   ITDEAGGAFLNFLKRIERYTNVNHIKLQGSTSPHISHNRRDAKLRILVDELDWNLVISW
FT                   NGPLELQERADIDEMAEPTSPERPRSETPLLSRISGDNNFDRIDDSEVNTLQESGPDTN
FT                   SHTNGFLEQVQQAEDESSLVQEVIIRSKDLKVCSKLFAAFEEVIMAISHDYACVFHCSL
FT                   SRGLRDTQTQEEKENGQIIYYISRSKALEFA"
     MKLKLEINGN DYPENFKLLK TTVTTVASLR SLAVLRFDSD RLVIISTPRV SNGVVAGHGV        60
     VARDSGELWC TIPRDVFSLY HVSAERQNNT IALECNVESL KNAVLRYDKV MTQGSASTLQ       120
     LKLRQMPEWN AASANGPDSA GNSRIRVAAL AVSFEELVNV YSGQGKDDAF MDATQNNTSH       180
     AVNKLISHSS KIPVRFLNAQ QDERIQEPMM DYNQTMLCRL PSITDEAGGA FLNFLKRIER       240
     YTNVNHIKLQ GSTSPHISHN RRDAKLRILV DELDWNLVIS WNGPLELQER ADIDEMAEPT       300
     SPERPRSETP LLSRISGDNN FDRIDDSEVN TLQESGPDTN SHTNGFLEQV QQAEDESSLV       360
     QEVIIRSKDL KVCSKLFAAF EEVIMAISHD YACVFHCSLS RGLRDTQTQE EKENGQIIYY       420
     ISRSKALEFA                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page