(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE429

CAGLA1_12.PE429      Location/Qualifiers
FT   CDS             975007..977817
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349527"
FT                   /locus_tag="CAGL0M09845g"
FT                   /product="Similar to uniprot|Q06078 Saccharomyces
FT                   cerevisiae YLR409c"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAG62752.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG053553"
FT                   /db_xref="HOGENOM:HBG735132"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B7183"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ20"
FT                   /transl_table=1
FT                   /translation="MSEVAKRRKLTSTKRYASKIFSPFRVIGNVSNGTPFAVGSLGSTF
FT                   YIVTSVGKSFQIYDANNLHLLFISDRETDEEISCLEAHFHYVYAGFGGKVGIYKRGILE
FT                   HTIEVGNGCKVTKLCVFGDYLCVSTDNNEVHIFKKENSTTDKYATKFYTKFEIPELVGG
FT                   DIVSVLHMPTYLNKIVVVTKINVLLYNVRSGKLLYSSPDFPDQLTVGEAAPALDIIALG
FT                   TISGEVILFNLRLGRKVRTIKVPNMRISSISFRTDGSSHICVGSSKGDILFYDLNRRAR
FT                   IHLLKNVHSEEFGGVTRASFLNGQPIIVTSGGDNSLKEYVFDPSLSQSDEDMVVQPPRF
FT                   LRSRGGHSQPATSIAFADDESHFILSASRDKSVWAFSLRKDAQSQELSQRLHKKNDGNR
FT                   VAGSTMREKFPEVSSIAIENARIGEWENILTAHNESKAARTWDMRSKRVGRWTFETIDD
FT                   GMVKSVAISQCGNFGFVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVS
FT                   CGLDGIIGFYDFNESKYLGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVV
FT                   RQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSPN
FT                   GDMLATTHVIGNGIFIWTNRAQFKQISTKAIDEDAFQKIMLPNASVSGNSQFLEGAFQD
FT                   GGDDHEPLDINNYQSVEQVNSELVTLSLGPRNKMNTILHLDVIKKRSKPKEAPKKPEKA
FT                   PFFLQLAGDKVGDEASGREGISFETPEEIRAREEKQKQSEEAQAELTKFKPGTNRGFQS
FT                   KFTKLLLHGNKQNQYEEFLEYLVSMSPATLDLEIRSLNSFEPFEEIIAFISALTAGLKT
FT                   NKNYELYEAIMNLLFKAHGDVIHANNTNCDLQDALSQWETVHGTEQKMDELVKFCSSVL
FT                   DFVSRS"
     MSEVAKRRKL TSTKRYASKI FSPFRVIGNV SNGTPFAVGS LGSTFYIVTS VGKSFQIYDA        60
     NNLHLLFISD RETDEEISCL EAHFHYVYAG FGGKVGIYKR GILEHTIEVG NGCKVTKLCV       120
     FGDYLCVSTD NNEVHIFKKE NSTTDKYATK FYTKFEIPEL VGGDIVSVLH MPTYLNKIVV       180
     VTKINVLLYN VRSGKLLYSS PDFPDQLTVG EAAPALDIIA LGTISGEVIL FNLRLGRKVR       240
     TIKVPNMRIS SISFRTDGSS HICVGSSKGD ILFYDLNRRA RIHLLKNVHS EEFGGVTRAS       300
     FLNGQPIIVT SGGDNSLKEY VFDPSLSQSD EDMVVQPPRF LRSRGGHSQP ATSIAFADDE       360
     SHFILSASRD KSVWAFSLRK DAQSQELSQR LHKKNDGNRV AGSTMREKFP EVSSIAIENA       420
     RIGEWENILT AHNESKAART WDMRSKRVGR WTFETIDDGM VKSVAISQCG NFGFVGSSNG       480
     GIGVYNMQSG MLRKKYRLHK RAVTGVAVDG MNRKMVSCGL DGIIGFYDFN ESKYLGKLQM       540
     DAPITSMVYH RSSDLCAFAL DDLSIVVVDT VTQKVVRQLW GHGNRITAFD FSPDGRWLVS       600
     ASLDSTIRTW DLPTGSCIDG VKIESVATNL KFSPNGDMLA TTHVIGNGIF IWTNRAQFKQ       660
     ISTKAIDEDA FQKIMLPNAS VSGNSQFLEG AFQDGGDDHE PLDINNYQSV EQVNSELVTL       720
     SLGPRNKMNT ILHLDVIKKR SKPKEAPKKP EKAPFFLQLA GDKVGDEASG REGISFETPE       780
     EIRAREEKQK QSEEAQAELT KFKPGTNRGF QSKFTKLLLH GNKQNQYEEF LEYLVSMSPA       840
     TLDLEIRSLN SFEPFEEIIA FISALTAGLK TNKNYELYEA IMNLLFKAHG DVIHANNTNC       900
     DLQDALSQWE TVHGTEQKMD ELVKFCSSVL DFVSRS                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page