(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE434

CAGLA1_12.PE434      Location/Qualifiers
FT   CDS             complement(982943..984334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440112"
FT                   /locus_tag="CAGL0M09955g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62757.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG190857"
FT                   /db_xref="HOGENOM:HBG396734"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B7188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ15"
FT                   /transl_table=1
FT                   /translation="MEYNSLMMDAHDVGEYEMGDAFKATHLNVKDGGGQRMSYSVSPSS
FT                   RPLMTAGEEVVHHIPTRGPSDAQAARLRRDSIAHSQGIGGVSWGSLSISSWLRDEVMLQ
FT                   HPSSQQSYQNQERKFSINNGLLQIQMNAPIGQGPISASTNTFLPHLEEQYCKDYSCCGI
FT                   SLPGLHDLLRHYEEAHISTSPGTSMSRPVGGSDASMGMSTGTVQTRNLMDRSMGSHGMS
FT                   PPTPMSSQSKIGSNTSINMHQISGANNNNNIKSKYMVNRGHNSNNIVDTVSTNEVFLNN
FT                   GRGTTSMETSRGTQPIHKHAHPQALQNMMMPPNNGSTQGLHSSNVDIAIDDDDDDEDDD
FT                   DDDEDDEEEEEQDKKEFYIDDPARRLYVMDHEEYKPFKCPVIGCDKTYKNQNGLKYHRL
FT                   HGHQNQTLRENADGTFSVIDPESNEVSTLDAMGNDKDKPYRCEVCGKRYKNLNGLKYHR
FT                   GHSTH"
     MEYNSLMMDA HDVGEYEMGD AFKATHLNVK DGGGQRMSYS VSPSSRPLMT AGEEVVHHIP        60
     TRGPSDAQAA RLRRDSIAHS QGIGGVSWGS LSISSWLRDE VMLQHPSSQQ SYQNQERKFS       120
     INNGLLQIQM NAPIGQGPIS ASTNTFLPHL EEQYCKDYSC CGISLPGLHD LLRHYEEAHI       180
     STSPGTSMSR PVGGSDASMG MSTGTVQTRN LMDRSMGSHG MSPPTPMSSQ SKIGSNTSIN       240
     MHQISGANNN NNIKSKYMVN RGHNSNNIVD TVSTNEVFLN NGRGTTSMET SRGTQPIHKH       300
     AHPQALQNMM MPPNNGSTQG LHSSNVDIAI DDDDDDEDDD DDDEDDEEEE EQDKKEFYID       360
     DPARRLYVMD HEEYKPFKCP VIGCDKTYKN QNGLKYHRLH GHQNQTLREN ADGTFSVIDP       420
     ESNEVSTLDA MGNDKDKPYR CEVCGKRYKN LNGLKYHRGH STH                         463
//

If you have problems or comments...

PBIL Back to PBIL home page