(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE436

CAGLA1_12.PE436      Location/Qualifiers
FT   CDS             987540..996914
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113101" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349528"
FT                   /locus_tag="CAGL0M09999g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62759.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG059043"
FT                   /db_xref="HOGENOM:HBG204174"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniParc:UPI00003B718A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ13"
FT                   /transl_table=1
FT                   /translation="MSHFGKSGHRRFSSSGNKPDSRHVSAHHRVPPPRPPRPTTPITNA
FT                   TPNVLSPESGQSSAGSRGSHRQSLSNPIGKSKMTETLVYHLFFDRILPVLPVESTLTTY
FT                   REVESDQFFISCRGVIMNVALSRDLNPVIDYSLQLIESLTESRELISDEINEDVAQSVL
FT                   VLLRLLSDTLEFCWESKESPEDKVKDEPSFENIPIDDNKEYVNMGEQARAGNMFTGSTI
FT                   GYSTHKPGFHRVPPPQIDSTLATRLLSVCTRLKYNTRTLRVLKNMSKNLYGNGTITYSS
FT                   VLPKFQAWLKYHNYPKYTETVDLTIDYILRFIAAANPADYDKYVDSKVTNPLLISHTLT
FT                   ELGIVKYLDFFGCVFLTPENVGPFLETLRHLSGFMKRTIFHSLLLYYSSKAFLFWILSR
FT                   PNEYVQLYYALQNLDSSKSNTFHQGNSNSSIATIPYCVSVLFDDIYSTFNVSSLLTNIY
FT                   DTRGHNGSTTQPVETEQSQATSPGSTNPVLFSPTLTSNDGIITSPTMGSNQIASPLSPL
FT                   PMSLDFNSRTQAQGFPLEETASIHSSKRSYNIDESVYSTMGSTHSNINTPTTNASFTHP
FT                   NEDEIPTSGSGHLQYVLELFSNYEETELSSHTSILRFLLSLILLDTDVFTDINAMTFRY
FT                   IPDTSKIIQQYSQKQGTRDAGAGTHMQNDDPSKEKEKNQSIKQITHGLKKLTNLSSSKK
FT                   KTVKFITMLIRNLNGAQMVSDVSLVDSLKTLVALVTLTSSISLIDSNLPSVLFAKRIFS
FT                   ILGHNLDVGKNWESKTNGFIASCTERNPISHRRLQLEFFAAAIQLDSDKLLSHIHLERE
FT                   LAGLNLRRLLLYTEGFKVFFNLLSSDVLRKKVALSSSNFLKSLFCIIADILLKAFPYFD
FT                   AKVTSIVSSILDGSILEKYDTIKTLAGLEPSNPPVLDRTDSSVKLKLQKKITNWDVHEV
FT                   LPTLSAVSSSSDINLSDTGKSIAESTERRSNTSTPAHTSTPANLTHNPLSTIASPPSTP
FT                   GSIGNYRNNPGMNVLSPHARRLQNVKIDSPQVEGERTRQSPYYFGATSTGEYSNQSVSH
FT                   SSLPKTTRSSGSQEKSRRSSDDKNKPQLKMQDSDDVIVLKTNENDDARRIMINIFSIFK
FT                   KMTNYFILPHDQNLNTIWVSKDFRNIMKPIFVAIIDTDTRLQTTAQSFMDVLIRYISKF
FT                   SSDITARSLNEHYLLCNYTITLFAASLFDLKLDNKKREIILRIVVKFLNVKSDLSRIAA
FT                   QKDLQYALYSTELVTFPLLTATVGGGLFISLYCNKGEIPRLLKKGFGEFLFAINCYEKH
FT                   VGEIDRTCIYNLGFIVAMSRDNYAASGSVAFQRRLRNKILHHIKRPDTILLDAMDVIYR
FT                   KWSSYMRKENITQEELIDFRSLAGILASMSGILLSFGETSTDNVPHLFEFRGDLIKKMD
FT                   YFVFKQCQWLNNPDLLTRENSRDILSMELHPLSFNILFDNLRIKIEELRSVNLSQKVHE
FT                   SSFVLLEQIITIVRTVLNRDDDERIMLLFSIRVVSTIDQLSDLVEKIPHSSVKYYKAII
FT                   QMAKLFRAIQHSEISLGIKNHFYLKNKWLKLLTNWFKVTISIDYDFDNLSKPLREMDLK
FT                   KRDLDFLYIDTAIETSKAVAYLTENVPLDIPPSASKDELERASTIVFGNYFTIFLKGLE
FT                   KSTDIQRFPVSLKHKITILNENVILSLTNLSNANVDASLQFTLPMGYSKDKNIRIAFLK
FT                   VFINIVTNYPKLKVESERKKLYAVDQLVQYLIEHPHLAFQAGIICPASDVDAFVAGLVN
FT                   GFDSRNASHILVTQLIKDEIDRASRYADVLRRNSCATRALSLYARSKGQSYLVRTLKPV
FT                   LDEFFESRDSFEIEKILPDDPEAEKNVDMFIHYMSKLINAITESVDYFPPELINICQTI
FT                   FHSVKEKFPDYSFIAVGSFVFLRFLGPAIVSPDAENIILISQTRDKRPLITLAKVLQNM
FT                   ANGSENLTRWPILNKKLDIFKDFSNRIFEFLSKICTIDSKPNIEIRRDPEPYYFEFNFL
FT                   HKFLYEHELEIRKMIVESLVSLDDFDYVRKTFLFVDDIMGVLGRPKVELKNEIPPYIVE
FT                   HMEENPHLYEFMNRNAFKNVSLGDEYEPFMHESMSLDGLPIITITFRKFEAENIEVDAI
FT                   VYRTIQVYSKMWMTKHYLVLDCTGSDSIDMNYNKLTSLFFSLLPDIAIENCIGAIYFNV
FT                   SENFMNQWVNVLRGDNPYLVAQVPHHFINSSSDQEQVKTLGLTGKGADVVQDTRVSLHD
FT                   ISLYHEDTKNLENVSLKIGNRYIQILHEATKQYKLHALNQILNIPFNDVYEIVDLATVG
FT                   VSSITGLPNEFTINFINGKRLVLVSKKYLEIVKMFNYAQLKIEDEYGTESQNRELTSTH
FT                   EESYVKESQEIICHLSLVILNGLFNDDNEVKNISYNLLVVTQNAFNLNFGSRFQKAPEV
FT                   YVPDNTTTFLSTIARALAESSPELTLHMWTYFLEGLENDVIPHEHIPTIICCLSYWVPN
FT                   LYRYVYLVDEEEGANNLSKIIRSLIQLTVKDPDFTTVYLQQIWFLLVLDDRLTSVTVEE
FT                   FVTHALDRDSESRDWKKAVSLLTAFPTVEVACQVIGKLMDIIKSFLPSLKMEVSTHSWS
FT                   ELEILVRISVSLFFESPLLTQMCLPEVLFIISLLIDIGPTHIRYCLHELLMNICHSLMI
FT                   NSSLPKENSERLDGICAVFARQKLNFMSGFSQEKGRILPNFSASSFSSKFGTLDHFVTN
FT                   VFKLMEYGSTSEAAQWKTKYKKYLLGCVFNHESFLSARAIMILGIIGKIDTNEILCRDL
FT                   LAETMKIFAEPVVTDEQLFVGISHIFTYSKIVAGLDPAGQMLPRMFWLATVFVESPHPI
FT                   LFEGGLQFLINCLKHLYEYHYKINNTEKLISELLIESRSFASELLEELEGYTDCLWTKD
FT                   NFEHLILGFITRGLSLAVLRGVALDCLMTAFKYSFREHQMIPRTSHHLNYLFLLYLVSN
FT                   QETFLNLLDSVGFESDYIELDDNIKIPRALVEWISSDNECSNITLYQGALLFASPASDE
FT                   PSKLRFELLTRYLLGISPKCVFRYYFVTRQELRRISSLEQQSDSSTIAFEIAGMLVMHD
FT                   DFDILDIYNKDSVQLLKSRGLFSLTKVNIFGRSFEDIMNSLQENSDQIYNRKRLTTLII
FT                   SKIIYQSQLTL"
     MSHFGKSGHR RFSSSGNKPD SRHVSAHHRV PPPRPPRPTT PITNATPNVL SPESGQSSAG        60
     SRGSHRQSLS NPIGKSKMTE TLVYHLFFDR ILPVLPVEST LTTYREVESD QFFISCRGVI       120
     MNVALSRDLN PVIDYSLQLI ESLTESRELI SDEINEDVAQ SVLVLLRLLS DTLEFCWESK       180
     ESPEDKVKDE PSFENIPIDD NKEYVNMGEQ ARAGNMFTGS TIGYSTHKPG FHRVPPPQID       240
     STLATRLLSV CTRLKYNTRT LRVLKNMSKN LYGNGTITYS SVLPKFQAWL KYHNYPKYTE       300
     TVDLTIDYIL RFIAAANPAD YDKYVDSKVT NPLLISHTLT ELGIVKYLDF FGCVFLTPEN       360
     VGPFLETLRH LSGFMKRTIF HSLLLYYSSK AFLFWILSRP NEYVQLYYAL QNLDSSKSNT       420
     FHQGNSNSSI ATIPYCVSVL FDDIYSTFNV SSLLTNIYDT RGHNGSTTQP VETEQSQATS       480
     PGSTNPVLFS PTLTSNDGII TSPTMGSNQI ASPLSPLPMS LDFNSRTQAQ GFPLEETASI       540
     HSSKRSYNID ESVYSTMGST HSNINTPTTN ASFTHPNEDE IPTSGSGHLQ YVLELFSNYE       600
     ETELSSHTSI LRFLLSLILL DTDVFTDINA MTFRYIPDTS KIIQQYSQKQ GTRDAGAGTH       660
     MQNDDPSKEK EKNQSIKQIT HGLKKLTNLS SSKKKTVKFI TMLIRNLNGA QMVSDVSLVD       720
     SLKTLVALVT LTSSISLIDS NLPSVLFAKR IFSILGHNLD VGKNWESKTN GFIASCTERN       780
     PISHRRLQLE FFAAAIQLDS DKLLSHIHLE RELAGLNLRR LLLYTEGFKV FFNLLSSDVL       840
     RKKVALSSSN FLKSLFCIIA DILLKAFPYF DAKVTSIVSS ILDGSILEKY DTIKTLAGLE       900
     PSNPPVLDRT DSSVKLKLQK KITNWDVHEV LPTLSAVSSS SDINLSDTGK SIAESTERRS       960
     NTSTPAHTST PANLTHNPLS TIASPPSTPG SIGNYRNNPG MNVLSPHARR LQNVKIDSPQ      1020
     VEGERTRQSP YYFGATSTGE YSNQSVSHSS LPKTTRSSGS QEKSRRSSDD KNKPQLKMQD      1080
     SDDVIVLKTN ENDDARRIMI NIFSIFKKMT NYFILPHDQN LNTIWVSKDF RNIMKPIFVA      1140
     IIDTDTRLQT TAQSFMDVLI RYISKFSSDI TARSLNEHYL LCNYTITLFA ASLFDLKLDN      1200
     KKREIILRIV VKFLNVKSDL SRIAAQKDLQ YALYSTELVT FPLLTATVGG GLFISLYCNK      1260
     GEIPRLLKKG FGEFLFAINC YEKHVGEIDR TCIYNLGFIV AMSRDNYAAS GSVAFQRRLR      1320
     NKILHHIKRP DTILLDAMDV IYRKWSSYMR KENITQEELI DFRSLAGILA SMSGILLSFG      1380
     ETSTDNVPHL FEFRGDLIKK MDYFVFKQCQ WLNNPDLLTR ENSRDILSME LHPLSFNILF      1440
     DNLRIKIEEL RSVNLSQKVH ESSFVLLEQI ITIVRTVLNR DDDERIMLLF SIRVVSTIDQ      1500
     LSDLVEKIPH SSVKYYKAII QMAKLFRAIQ HSEISLGIKN HFYLKNKWLK LLTNWFKVTI      1560
     SIDYDFDNLS KPLREMDLKK RDLDFLYIDT AIETSKAVAY LTENVPLDIP PSASKDELER      1620
     ASTIVFGNYF TIFLKGLEKS TDIQRFPVSL KHKITILNEN VILSLTNLSN ANVDASLQFT      1680
     LPMGYSKDKN IRIAFLKVFI NIVTNYPKLK VESERKKLYA VDQLVQYLIE HPHLAFQAGI      1740
     ICPASDVDAF VAGLVNGFDS RNASHILVTQ LIKDEIDRAS RYADVLRRNS CATRALSLYA      1800
     RSKGQSYLVR TLKPVLDEFF ESRDSFEIEK ILPDDPEAEK NVDMFIHYMS KLINAITESV      1860
     DYFPPELINI CQTIFHSVKE KFPDYSFIAV GSFVFLRFLG PAIVSPDAEN IILISQTRDK      1920
     RPLITLAKVL QNMANGSENL TRWPILNKKL DIFKDFSNRI FEFLSKICTI DSKPNIEIRR      1980
     DPEPYYFEFN FLHKFLYEHE LEIRKMIVES LVSLDDFDYV RKTFLFVDDI MGVLGRPKVE      2040
     LKNEIPPYIV EHMEENPHLY EFMNRNAFKN VSLGDEYEPF MHESMSLDGL PIITITFRKF      2100
     EAENIEVDAI VYRTIQVYSK MWMTKHYLVL DCTGSDSIDM NYNKLTSLFF SLLPDIAIEN      2160
     CIGAIYFNVS ENFMNQWVNV LRGDNPYLVA QVPHHFINSS SDQEQVKTLG LTGKGADVVQ      2220
     DTRVSLHDIS LYHEDTKNLE NVSLKIGNRY IQILHEATKQ YKLHALNQIL NIPFNDVYEI      2280
     VDLATVGVSS ITGLPNEFTI NFINGKRLVL VSKKYLEIVK MFNYAQLKIE DEYGTESQNR      2340
     ELTSTHEESY VKESQEIICH LSLVILNGLF NDDNEVKNIS YNLLVVTQNA FNLNFGSRFQ      2400
     KAPEVYVPDN TTTFLSTIAR ALAESSPELT LHMWTYFLEG LENDVIPHEH IPTIICCLSY      2460
     WVPNLYRYVY LVDEEEGANN LSKIIRSLIQ LTVKDPDFTT VYLQQIWFLL VLDDRLTSVT      2520
     VEEFVTHALD RDSESRDWKK AVSLLTAFPT VEVACQVIGK LMDIIKSFLP SLKMEVSTHS      2580
     WSELEILVRI SVSLFFESPL LTQMCLPEVL FIISLLIDIG PTHIRYCLHE LLMNICHSLM      2640
     INSSLPKENS ERLDGICAVF ARQKLNFMSG FSQEKGRILP NFSASSFSSK FGTLDHFVTN      2700
     VFKLMEYGST SEAAQWKTKY KKYLLGCVFN HESFLSARAI MILGIIGKID TNEILCRDLL      2760
     AETMKIFAEP VVTDEQLFVG ISHIFTYSKI VAGLDPAGQM LPRMFWLATV FVESPHPILF      2820
     EGGLQFLINC LKHLYEYHYK INNTEKLISE LLIESRSFAS ELLEELEGYT DCLWTKDNFE      2880
     HLILGFITRG LSLAVLRGVA LDCLMTAFKY SFREHQMIPR TSHHLNYLFL LYLVSNQETF      2940
     LNLLDSVGFE SDYIELDDNI KIPRALVEWI SSDNECSNIT LYQGALLFAS PASDEPSKLR      3000
     FELLTRYLLG ISPKCVFRYY FVTRQELRRI SSLEQQSDSS TIAFEIAGML VMHDDFDILD      3060
     IYNKDSVQLL KSRGLFSLTK VNIFGRSFED IMNSLQENSD QIYNRKRLTT LIISKIIYQS      3120
     QLTL                                                                   3124
//

If you have problems or comments...

PBIL Back to PBIL home page