(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE440

CAGLA1_12.PE440      Location/Qualifiers
FT   CDS             1005238..1006344
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045140"
FT                   /locus_tag="CAGL0M10087g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62763.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG124129"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00003B718E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ09"
FT                   /transl_table=1
FT                   /translation="MNNEPFDILGLMQGPHFSNSGDDIYTNGRMEVKYPPIGIDDEGQN
FT                   ISGNGIGLDYAPFTPAGLSGSGQSAMANFQQQNNINSAGFQTQLTPSNIELHNNLQNLR
FT                   TPPDIIKTEQSISPNLDFSTSINGNFNTNNSISGDSNNDKLNTTARSTFSHHRENSNPG
FT                   DNIDDKKKAQNRAAQRAFRERKEAKFKELQRKVRESEIDRDQLLKELEKLRKWNMEINA
FT                   ENRKLLQKERLGNNGVYSGNMECSSSQSLPNMEQTTYIFPSTNECFEQSINQKNLRDKN
FT                   PEQIFERKPVYSAAGRFLQYEDEYPDDVLLTVPETWEYLSQLSENEEFDVHEVMERLVG
FT                   LEQCHPSGPAYSKQRIDNLVKQSIENNR"
     MNNEPFDILG LMQGPHFSNS GDDIYTNGRM EVKYPPIGID DEGQNISGNG IGLDYAPFTP        60
     AGLSGSGQSA MANFQQQNNI NSAGFQTQLT PSNIELHNNL QNLRTPPDII KTEQSISPNL       120
     DFSTSINGNF NTNNSISGDS NNDKLNTTAR STFSHHRENS NPGDNIDDKK KAQNRAAQRA       180
     FRERKEAKFK ELQRKVRESE IDRDQLLKEL EKLRKWNMEI NAENRKLLQK ERLGNNGVYS       240
     GNMECSSSQS LPNMEQTTYI FPSTNECFEQ SINQKNLRDK NPEQIFERKP VYSAAGRFLQ       300
     YEDEYPDDVL LTVPETWEYL SQLSENEEFD VHEVMERLVG LEQCHPSGPA YSKQRIDNLV       360
     KQSIENNR                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page