(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE442

CAGLA1_12.PE442      Location/Qualifiers
FT   CDS             1008833..1010461
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440116"
FT                   /locus_tag="CAGL0M10131g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /protein_id="CAG62765.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG058165"
FT                   /db_xref="HOGENOM:HBG202317"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI00003B7190"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ07"
FT                   /transl_table=1
FT                   /translation="MDYMNLGLRSRKTGIDVKKNLAKDEYSMENIDDFFKDDDTSFLSR
FT                   RKSRKSSLLPEADIQNRILPSPLTKQHNVRDTDGFKVPQNINVSHRSTIERAPTEFQHS
FT                   VISEDIPEVIPYEGQSATPDRNIEPIDEDELANMPKPRYRSQYNLGAGNDDTDLINLTP
FT                   EKDGRGTYNDVPDLIDDEGDTSKDNTTFNTSDHAMLEDEVEDGFVLESEEDRDYMESDE
FT                   GSLADDTDDASDSGDDIGTQFAAEINRPGNESPLSSDDEDYISENSTGHNRLEDEIDNP
FT                   SLPTRLSKPYDIVDGVRRSKRVKIPPLEYWRNEKIQYKRRRNEPVLDIDKVITYNHSES
FT                   EEESEEEQKKVKKQRKPVTRTRPYNYVPNGRPRGRPRKNISDDPNGNLIRKIENGEEPK
FT                   GEWLKHGMLEATVKNLHGEAKTELVAMAPNVSQSEETKASGEDDYSIEILFDKYNEAFA
FT                   SGMLKVPVDGRKSPADSNTAFITFHVLDGIVEVTLDGKNFICTKGSSFQIPAYNEYAFA
FT                   NIGSNEVRMFFVQVSPPSDFYSEHY"
     MDYMNLGLRS RKTGIDVKKN LAKDEYSMEN IDDFFKDDDT SFLSRRKSRK SSLLPEADIQ        60
     NRILPSPLTK QHNVRDTDGF KVPQNINVSH RSTIERAPTE FQHSVISEDI PEVIPYEGQS       120
     ATPDRNIEPI DEDELANMPK PRYRSQYNLG AGNDDTDLIN LTPEKDGRGT YNDVPDLIDD       180
     EGDTSKDNTT FNTSDHAMLE DEVEDGFVLE SEEDRDYMES DEGSLADDTD DASDSGDDIG       240
     TQFAAEINRP GNESPLSSDD EDYISENSTG HNRLEDEIDN PSLPTRLSKP YDIVDGVRRS       300
     KRVKIPPLEY WRNEKIQYKR RRNEPVLDID KVITYNHSES EEESEEEQKK VKKQRKPVTR       360
     TRPYNYVPNG RPRGRPRKNI SDDPNGNLIR KIENGEEPKG EWLKHGMLEA TVKNLHGEAK       420
     TELVAMAPNV SQSEETKASG EDDYSIEILF DKYNEAFASG MLKVPVDGRK SPADSNTAFI       480
     TFHVLDGIVE VTLDGKNFIC TKGSSFQIPA YNEYAFANIG SNEVRMFFVQ VSPPSDFYSE       540
     HY                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page