(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE443

CAGLA1_12.PE443      Location/Qualifiers
FT   CDS             complement(1010688..1013291)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440117"
FT                   /locus_tag="CAGL0M10153g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62766.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG203842"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B7191"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ06"
FT                   /transl_table=1
FT                   /translation="MSAELKSHKLDRSIGSNKAGHEHPISRNYVNNVHNANKHKLSDYP
FT                   MMLTITHIGTSRLSSSSSSSSSSSSNSSSSSSYSRGFISDNLSEYRSMDPKSPNRPVRY
FT                   RSIHSKYTSIREDTQHELVTDKEEIQNNKEVSINILSKPNKHTSIDYHNQGVDTTYQIN
FT                   SGQISRHKQMSKSLPNTPKPLQYQKSLSLSHSPRKLSLKSPSRNFSFKSNSKLNVGTKH
FT                   DQEKKRPVKMKEVFSLFVNSIKVSNNSNNSNDRSDQEVPPKHDLKKVKSISKPYNPKHV
FT                   HHVGFDPVTGDYIGLPEKWQALLESNGITKKEQEKDIKTLLNVVQFYQDVSASKTTDKL
FT                   LQTFPLEKGTICVDDTQVSTPSNITSSADDDAAKPSFNESLMPAISIESRHKNEVNQLI
FT                   LKESFSTEDKFIPSRPAPKPPALQELKAIPPKSPNRPKATRVKNNSSKITSVNSLPNNG
FT                   EPTVQFSNDQKSHKSQRVGTSTDTFRFEKSLSGNKKTISITSTSTSTSKHPTNYRESWG
FT                   IKGHTDKKENSNVIKRDEGNKKAEKDKRMQVVLSRLSKICTPGTPEDKFETYLKIGQGA
FT                   SGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQNIVNYIDSYLSGL
FT                   DLWVVMEYMEGGCLTDVVTYCVLTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDNVLL
FT                   SMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIVSRKEYGPKVDIWSLGIMIIE
FT                   MIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSKDFKEFIDKCLAVTVSERAESSEL
FT                   LQHKFITEVAENTEGLSALVKFSRMKKAAEQNSDSEGRSSSSSSKAVASVESGIQ"
     MSAELKSHKL DRSIGSNKAG HEHPISRNYV NNVHNANKHK LSDYPMMLTI THIGTSRLSS        60
     SSSSSSSSSS NSSSSSSYSR GFISDNLSEY RSMDPKSPNR PVRYRSIHSK YTSIREDTQH       120
     ELVTDKEEIQ NNKEVSINIL SKPNKHTSID YHNQGVDTTY QINSGQISRH KQMSKSLPNT       180
     PKPLQYQKSL SLSHSPRKLS LKSPSRNFSF KSNSKLNVGT KHDQEKKRPV KMKEVFSLFV       240
     NSIKVSNNSN NSNDRSDQEV PPKHDLKKVK SISKPYNPKH VHHVGFDPVT GDYIGLPEKW       300
     QALLESNGIT KKEQEKDIKT LLNVVQFYQD VSASKTTDKL LQTFPLEKGT ICVDDTQVST       360
     PSNITSSADD DAAKPSFNES LMPAISIESR HKNEVNQLIL KESFSTEDKF IPSRPAPKPP       420
     ALQELKAIPP KSPNRPKATR VKNNSSKITS VNSLPNNGEP TVQFSNDQKS HKSQRVGTST       480
     DTFRFEKSLS GNKKTISITS TSTSTSKHPT NYRESWGIKG HTDKKENSNV IKRDEGNKKA       540
     EKDKRMQVVL SRLSKICTPG TPEDKFETYL KIGQGASGGV YLSHSRSDKS QCVAIKQMNL       600
     EKQPKKELIV NEIMVMSSSK HQNIVNYIDS YLSGLDLWVV MEYMEGGCLT DVVTYCVLTE       660
     GQIGAVCREV LQGLEFLHSK GVLHRDIKSD NVLLSMNGDI KLTDFGFCAQ VNDTVIKRTT       720
     MVGTPYWMAP EIVSRKEYGP KVDIWSLGIM IIEMIEGEPP YLNETPLRAL YLIATNGRPE       780
     VQEPDRLSKD FKEFIDKCLA VTVSERAESS ELLQHKFITE VAENTEGLSA LVKFSRMKKA       840
     AEQNSDSEGR SSSSSSKAVA SVESGIQ                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page