(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE444

CAGLA1_12.PE444      Location/Qualifiers
FT   CDS             complement(1014414..1018844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440118"
FT                   /locus_tag="CAGL0M10175g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="acid-amino acid ligase activity"
FT                   /function="binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62767.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG058164"
FT                   /db_xref="HOGENOM:HBG202351"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B7192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ05"
FT                   /transl_table=1
FT                   /translation="MDDHSTDYEMDDHYTDGEEDEVQYVYPDGEEEDSDDDGLGDDYDG
FT                   EGDGMFHSLDEDEDHEGVEDDIDEEIDGDGFDVEGAIPAAFGGRRVRVATQPAMNLQEL
FT                   LGTLSQHMGQAQQNRRNTTNAGDTSTPPANATFSDFISMFSSRMAREGGTGSRNSRMVK
FT                   LVENIANASEDSYIAMESLREISENLLMTNQLLLDRIIPMDELLVAVIDILKDPMLSQE
FT                   SELQVQACRCLHNLYEVNIDSMSSSVDQNIIQILQDKLQQIDFIDLAEQVLETLEYLSR
FT                   IQGKDICRNGEMSIYIRYYDFFTVHAQRKAVYIVTNALTNAIEADFVNIKEVFPSLTQI
FT                   FMNTNDSNVISHILNAYTGVCRNIKNSDQLVSLFLPSLFDKILQILSNVDSQLEDKLKC
FT                   INIMTLLVSQCLDLKRHFLRREEPVQDIMLCLNVYAKNNSTKINDKLMFVPKKLLLSVT
FT                   RFITALLPSEEDSLLSNNVLTEVEIDGSNIYLDRIFKDLTPLLIELYGNTTDFEMKEYV
FT                   LVCMARISTHTKQTDVQKLCKHLLPCLASILSHIQNNDLLATSLDNIISDKQMEQWILC
FT                   TATLSILRILLNKFGDVVANSMKREGINIMINSISEKVKEFTGLNLRSIELKHVSHDNN
FT                   EDESSDSDSANNEDNYDISVPDYVKPKAIKFNLLSYPSPEKTLKYLELYCDELTDIAPL
FT                   YRTNSNEELDSIKQTINFMADIEVETFDAEKCDKLWRMLYSNIFGNDEELSGFEMISTG
FT                   LGKAVATLLEQLSNNYQIRKSFEKIFSSKAINLVTLLQSTLNRVENFPIIDSGISGESG
FT                   VSLLTKLLKLELVIDENLEELGLPKNLETTNVQIHCIATYTNLKDFIKQRFLKVQFLDN
FT                   LLPNSSIRNNESNPNSADALDSLLKEKNMEFYFEDYQIDSNDTIFGGLLKAYEKLDKSI
FT                   RDVWQKSQRIKVKFVSKSDKFEETQGDEKESISRMKSSTPADHDDPALDILKILKFLHN
FT                   CSISAENFVNTKLSSKLARQLDEPLIVLSIRLPEWATLLTKEFSFLFPFETRMFALQCI
FT                   SFDQGRLIQLWKSRVDSSSKINTDEQLEHLGRVVRHKLRIPRKDMFSTGVKVLKRFGGD
FT                   STVMEVEYIDEVGTGLGPTLEFYAIISKEFARKSLNMWHCLDDNMKHVADGTPNDNTMS
FT                   EVYVLNPLFPAPMIPEEKKRDEVLDLFNQLGVFVARSLYDNRILDFRFNPVFFMLCHAI
FT                   TKNEGLSTLTLDSDQVYQQLSILANIDSQLAASLRYIYNNRTNTPLIKSLSLTFTLPGY
FT                   NFELVEHGNDHAVDDLTSVEKYISLVLDMFLGTGIAPQLNSFIDGFSRLFPYKNMLLFS
FT                   PNEIADLFGRVEEDWSPETLFTYLVADHGYTMDSPTIRDLISIISTFDNQEKRMFLQFL
FT                   TGSPKLPLGGFKSLKPKLTVVLKHAEDGLQPDDYLPSVMTCANYLKLPKYSSREVMRQQ
FT                   ILTAMTEGADSFQLS"
     MDDHSTDYEM DDHYTDGEED EVQYVYPDGE EEDSDDDGLG DDYDGEGDGM FHSLDEDEDH        60
     EGVEDDIDEE IDGDGFDVEG AIPAAFGGRR VRVATQPAMN LQELLGTLSQ HMGQAQQNRR       120
     NTTNAGDTST PPANATFSDF ISMFSSRMAR EGGTGSRNSR MVKLVENIAN ASEDSYIAME       180
     SLREISENLL MTNQLLLDRI IPMDELLVAV IDILKDPMLS QESELQVQAC RCLHNLYEVN       240
     IDSMSSSVDQ NIIQILQDKL QQIDFIDLAE QVLETLEYLS RIQGKDICRN GEMSIYIRYY       300
     DFFTVHAQRK AVYIVTNALT NAIEADFVNI KEVFPSLTQI FMNTNDSNVI SHILNAYTGV       360
     CRNIKNSDQL VSLFLPSLFD KILQILSNVD SQLEDKLKCI NIMTLLVSQC LDLKRHFLRR       420
     EEPVQDIMLC LNVYAKNNST KINDKLMFVP KKLLLSVTRF ITALLPSEED SLLSNNVLTE       480
     VEIDGSNIYL DRIFKDLTPL LIELYGNTTD FEMKEYVLVC MARISTHTKQ TDVQKLCKHL       540
     LPCLASILSH IQNNDLLATS LDNIISDKQM EQWILCTATL SILRILLNKF GDVVANSMKR       600
     EGINIMINSI SEKVKEFTGL NLRSIELKHV SHDNNEDESS DSDSANNEDN YDISVPDYVK       660
     PKAIKFNLLS YPSPEKTLKY LELYCDELTD IAPLYRTNSN EELDSIKQTI NFMADIEVET       720
     FDAEKCDKLW RMLYSNIFGN DEELSGFEMI STGLGKAVAT LLEQLSNNYQ IRKSFEKIFS       780
     SKAINLVTLL QSTLNRVENF PIIDSGISGE SGVSLLTKLL KLELVIDENL EELGLPKNLE       840
     TTNVQIHCIA TYTNLKDFIK QRFLKVQFLD NLLPNSSIRN NESNPNSADA LDSLLKEKNM       900
     EFYFEDYQID SNDTIFGGLL KAYEKLDKSI RDVWQKSQRI KVKFVSKSDK FEETQGDEKE       960
     SISRMKSSTP ADHDDPALDI LKILKFLHNC SISAENFVNT KLSSKLARQL DEPLIVLSIR      1020
     LPEWATLLTK EFSFLFPFET RMFALQCISF DQGRLIQLWK SRVDSSSKIN TDEQLEHLGR      1080
     VVRHKLRIPR KDMFSTGVKV LKRFGGDSTV MEVEYIDEVG TGLGPTLEFY AIISKEFARK      1140
     SLNMWHCLDD NMKHVADGTP NDNTMSEVYV LNPLFPAPMI PEEKKRDEVL DLFNQLGVFV      1200
     ARSLYDNRIL DFRFNPVFFM LCHAITKNEG LSTLTLDSDQ VYQQLSILAN IDSQLAASLR      1260
     YIYNNRTNTP LIKSLSLTFT LPGYNFELVE HGNDHAVDDL TSVEKYISLV LDMFLGTGIA      1320
     PQLNSFIDGF SRLFPYKNML LFSPNEIADL FGRVEEDWSP ETLFTYLVAD HGYTMDSPTI      1380
     RDLISIISTF DNQEKRMFLQ FLTGSPKLPL GGFKSLKPKL TVVLKHAEDG LQPDDYLPSV      1440
     MTCANYLKLP KYSSREVMRQ QILTAMTEGA DSFQLS                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page