(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE445

CAGLA1_12.PE445      Location/Qualifiers
FT   CDS             1019623..1020342
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177263" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196353"
FT                   /gene_name="MRT4"
FT                   /locus_tag="CAGL0M10197g"
FT                   /product="mRNA turnover protein 4 homolog "
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG62768.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG028195"
FT                   /db_xref="HOGENOM:HBG628300"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniParc:UPI00003B7193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ04"
FT                   /transl_table=1
FT                   /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYKYVFVLQL
FT                   DDVRTPVLQEIREAWVGSKLLMGKRKVLEKALGTTREQEYKENLSKLTKYCSGVIGLLF
FT                   TNETLDTVKEYFEAYSRLDYSRPNSRAPITFEVPEGIVYSRGGQIPIEEDVPMAHSLEP
FT                   TLRNKYEMPTKIKAGKITLEAPYLVCKEGQKLDVRQALILKQFGVALAQFKVIISAYYD
FT                   NESSTVSELNINKKQDA"
     MPRSKRSKLV TLAQTDKKGR ENKERIFDEV REALDTYKYV FVLQLDDVRT PVLQEIREAW        60
     VGSKLLMGKR KVLEKALGTT REQEYKENLS KLTKYCSGVI GLLFTNETLD TVKEYFEAYS       120
     RLDYSRPNSR APITFEVPEG IVYSRGGQIP IEEDVPMAHS LEPTLRNKYE MPTKIKAGKI       180
     TLEAPYLVCK EGQKLDVRQA LILKQFGVAL AQFKVIISAY YDNESSTVSE LNINKKQDA        239
//

If you have problems or comments...

PBIL Back to PBIL home page