(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE446

CAGLA1_12.PE446      Location/Qualifiers
FT   CDS             complement(1020895..1022088)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440119"
FT                   /locus_tag="CAGL0M10219g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62769.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058582"
FT                   /db_xref="HOGENOM:HBG738741"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniParc:UPI00003B7194"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ03"
FT                   /transl_table=1
FT                   /translation="MLKVETKQRPRRASSVGNIDLGDTVPGFATMHESKASKVAAKRRH
FT                   ERLATQRNLKMTTKLYLKARDYNYHHMWFLPLCILILTYAAYFGISNKRVKGFLHMFVA
FT                   ISYEQESNPQYYGKGIKDLAFVFFHMIFFTFLREFLMDVIIRRITQWLNITSKYKIKRM
FT                   MEQMFSIFYYGFSSPFGVYVMYHSDLWYFRTNTMYNTYPDILIPKLFKAFYLIQAAFWA
FT                   QQAFVLVLQLEKPRKDHKELCFHHVVTLLLIWSSYVFHFHKMGLAVYITMDVSDFFLAL
FT                   SKTLNYIDSPLTEVVFGMFVLVWIYLRHVINGKILWSVLTEFRTEGPYILNFATQQYKC
FT                   WISLPIVFVLIFALQVLNIYWLFLIFKVLYKIVWQGVTEDVRSDEETDSGSDELKKD"
     MLKVETKQRP RRASSVGNID LGDTVPGFAT MHESKASKVA AKRRHERLAT QRNLKMTTKL        60
     YLKARDYNYH HMWFLPLCIL ILTYAAYFGI SNKRVKGFLH MFVAISYEQE SNPQYYGKGI       120
     KDLAFVFFHM IFFTFLREFL MDVIIRRITQ WLNITSKYKI KRMMEQMFSI FYYGFSSPFG       180
     VYVMYHSDLW YFRTNTMYNT YPDILIPKLF KAFYLIQAAF WAQQAFVLVL QLEKPRKDHK       240
     ELCFHHVVTL LLIWSSYVFH FHKMGLAVYI TMDVSDFFLA LSKTLNYIDS PLTEVVFGMF       300
     VLVWIYLRHV INGKILWSVL TEFRTEGPYI LNFATQQYKC WISLPIVFVL IFALQVLNIY       360
     WLFLIFKVLY KIVWQGVTED VRSDEETDSG SDELKKD                                397
//

If you have problems or comments...

PBIL Back to PBIL home page